Property Summary

NCBI Gene PubMed Count 71
PubMed Score 210.81
PubTator Score 60.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 5.8e-26
Disease Target Count Z-score Confidence
Cancer 2346 3.148 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 5.8e-26

 GO Function (1)

Gene RIF (61)

PMID Text
26401002 repertoire of peptides eluted from MHC class I molecules was influenced by FAT10 expression
25983082 FAT10 is the only ubiquitin-like modifier known to date which directly targets its hundreds of substrates for degradation by the proteasome. (Review)
25768649 Conjugation of the ubiquitin activating enzyme UBE1 with the ubiquitin-like modifier FAT10 targets it for proteasomal degradation
25422469 the interaction of FAT10 with MAD2 is a key mechanism underlying the promalignant property of FAT10
25056121 Results identified a novel HCC regulatory circuit involving FAT10, beta-catenin/TCF4, and HOXB9, the dysfunction of which drives invasive and metastatic character in HCC.
24893112 transcription downregulation of the Ufm1 and FAT10 conjugation system in liver Mallory-Denk bodies formation
24518302 STAT3 and NFkappaB synergistically act for maximum induction of FAT10 expression.
24492942 FAT10 expression in pancreatic ductal adenocarcinoma (PDAC) was an independent prognostic factor of patients, which might be a potential diagnostic and therapeutic target of PDAC
24440736 These results suggest that knockdown of FAT10 by adenovirus-delivered siRNA may be a promising therapeutical strategy for treatment of hepatocellular carcinoma.
24325913 FAT10 can induce malignant transformation as evidenced from the anchorage-independent growth as well as in vivo tumor-forming abilities of FAT10-overexpressing NeHepLxHT cells.
23862649 functional distribution of the FAT10 targets suggests that FAT10 participates in various biological processes, such as translation, protein folding, RNA processing, and macromolecular complex assembly
23812429 FAT10 has a central role in regulating diverse aspects of the pathogenesis of hepatocellular carcinoma.
23416168 FAT10 protects cardiac myocytes against apoptosis.
23036196 FATylation of LRRFIP2 occurs on two distinct sites, each being modified by a single FAT10 moiety.
22797925 p62 becomes covalently mono-FAT10ylated at several lysines, and FAT10 colocalizes with p62 in p62 bodies.
22569823 This study identified eEF1A1 as a FAT10-specific binding protein, and when the expression of FAT10 was reduced by siRNA knockdown, this resulted in downregulation of eEF1A1 expression in hepatoma cells.
22434192 findings show how FAT10 and NUB1L dock with the 26S proteasome to initiate proteolysis; identified the 26S proteasome subunit hRpn10/S5a as the receptor for FAT10, whereas NUB1L can bind to both Rpn10 and Rpn1/S2.
22427669 Data indicate the potential role of cytokine-induced FAT10 expression in regulating Uba6 pathways.
22402871 Immunohistochemistry showed that FAT10 protein was over-expressed in glioma tissues. Expression level of FAT10 increase from grade I to grade IV glioma according to the results of real-time PCR, immunohistochemistry analysis and Western blot.
22349260 FAT10 modification of the HCMV-derived antigen pp65 (FAT10-pp65) enhances the presentation of the HLA-A2-restricted pp65495-509 antigenic peptide and provide evidence that FAT10- pp65 differs from Ub-modified pp65 in using the proteasome machinery.
22347407 implicate FAT10 in retinal cell biology and Leber congenital amaurosis pathogenesis, and reveal a new role of AIPL1 in regulating the FAT10 pathway.
22292662 Ten SNPs in FAT10 were identified.
22281738 In this study a crystal structure of linear diubiquitin at a resolution of 2.2 A degrees is reported.
22164771 An extract of bark from the tropical rainforest plant Byrsonima crassifolia was screened for inhibition of diubiquitin formation by the human ubiquitin-conjugating enzyme E2-25K.
22072791 Degradation of FAT10 is accelerated after induction of apoptosis, suggesting that it plays a role in prosurvival pathways
22025632 FAT10 plays an important role in mediating the function of TNF-alpha during tumorigenesis by inducing cell cycle deregulation and chromosomal instability.
21757738 new role for FAT10 in the pathogenesis of polyglutamine diseases.
21631897 Data indicate that the 20,000-bp region is telomeric of the UBD gene and contains LOC729653, a hypothetical gene.
21396347 The p53 transcriptional activity was found to be substantially enhanced in FAT10-overexpressing cells.
21351261 Genetic polymorphism in UBD is associated with colorectal cancer.
21121635 These data reveal that VHS domain of Stam2 enters the hydrophobic pocket of K48-linked diubiquitin and binds the two ubiquitin subunits with different affinities.
20975683 USE1 is not only the first E2 enzyme but also the first known substrate of FAT10 conjugation, as it was efficiently auto-FAT10ylated in cis but not in trans.
20587610 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19808075 Reverse transcriptase-polymerase chain reaction analysis of intestinal biopsy sample pairs (at diagnosis vs treated) from 30 celiac disease patients confirmed overexpression of UBD in active disease tissue.
19808075 Observational study of gene-disease association. (HuGE Navigator)
19726511 critical mediator of HIV Vpr-induced apoptosis in renal tubular epithelial cells
19726511 Monoubiquitinated forms of the HIV-1 matrix (MA), capsid (CA), and nucleocapsid (NC) proteins are detected in mature virus particles
19437562 Data show that FAT10 and mutant p53 levels in gastric cancer tissue were significantly correlated with lymph node metastasis and tumor, nodes, metastasis staging.
19303852 Study reports the crystal structure of the UBAN motif of NEMO bound to linear diubiquitin chains and provide structural and biochemical evidence for the specificity of this interaction versus interactions with Lys63- or Lys48-linked diubiquitin chains
19185524 Structural basis for recognition of diubiquitins by NEMO.
19033385 A new binding partner of HDAC6, the ubiquitin-like modifier FAT10 was identified.
18574467 FAT10 qualifies as a marker for an interferon response in hepatocellular carcinoma and colon carcinoma but is not significantly overexpressed in cancers lacking a proinflammatory environment.
17971048 Observational study of gene-disease association. (HuGE Navigator)
17889673 The identification of an E1-like protein, termed E1-L2, that activates both ubiquitin and another ubiquitin-like protein, FAT10, is reported.
17067581 Monoubiquitinated forms of the HIV-1 matrix (MA), capsid (CA), and nucleocapsid (NC) proteins are detected in mature virus particles
16808324 Monoubiquitinated forms of the HIV-1 matrix (MA), capsid (CA), and nucleocapsid (NC) proteins are detected in mature virus particles
16775314 Monoubiquitinated forms of the HIV-1 matrix (MA), capsid (CA), and nucleocapsid (NC) proteins are detected in mature virus particles
16707496 A deletion mutant of NUB1L lacking the UBL domain is still able to bind FAT10 but not the proteasome and no longer accelerates FAT10 degradation
16495380 Immunohistochemical studies demonstrated increased FAT10 expression in HIV-associated nephropathy and in autosomal dominant polycystic kidney disease.
16495226 high levels of FAT10 protein in cells lead to increased mitotic nondisjunction and chromosome instability, which is mediated by an abbreviated mitotic phase and reduction in the kinetochore localization of MAD2 during prometaphase
15994808 Monoubiquitinated forms of the HIV-1 matrix (MA), capsid (CA), and nucleocapsid (NC) proteins are detected in mature virus particles
15831455 FAT10 is degraded by the proteasome in ubiqitin-independent manner.
12883554 Monoubiquitinated forms of the HIV-1 matrix (MA), capsid (CA), and nucleocapsid (NC) proteins are detected in mature virus particles
12730673 FAT10 may modulate tumorigenesis through its reported interaction with the MAD2 spindle-assembly checkpoint protein.
12610113 Monoubiquitinated forms of the HIV-1 matrix (MA), capsid (CA), and nucleocapsid (NC) proteins are detected in mature virus particles
11991975 Monoubiquitinated forms of the HIV-1 matrix (MA), capsid (CA), and nucleocapsid (NC) proteins are detected in mature virus particles
11112487 Monoubiquitinated forms of the HIV-1 matrix (MA), capsid (CA), and nucleocapsid (NC) proteins are detected in mature virus particles
11087860 Monoubiquitinated forms of the HIV-1 matrix (MA), capsid (CA), and nucleocapsid (NC) proteins are detected in mature virus particles
11087859 Monoubiquitinated forms of the HIV-1 matrix (MA), capsid (CA), and nucleocapsid (NC) proteins are detected in mature virus particles
9525617 Monoubiquitinated forms of the HIV-1 matrix (MA), capsid (CA), and nucleocapsid (NC) proteins are detected in mature virus particles

AA Sequence

MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDK      1 - 70
EKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLE     71 - 140
DGKMMADYGIRKGNLLFLACYCIGG                                                 141 - 165
//

Text Mined References (74)

PMID Year Title
26401002 2015 The Ubiquitin-like Modifier FAT10 Is Selectively Expressed in Medullary Thymic Epithelial Cells and Modifies T Cell Selection.
25983082 2015 The ubiquitin-like modifier FAT10 in antigen processing and antimicrobial defense.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25768649 2015 Conjugation of the ubiquitin activating enzyme UBE1 with the ubiquitin-like modifier FAT10 targets it for proteasomal degradation.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25422469 2014 Disruption of FAT10-MAD2 binding inhibits tumor progression.
25056121 2014 Ubiquitin-like protein FAT10 promotes the invasion and metastasis of hepatocellular carcinoma by modifying ?-catenin degradation.
24893112 2014 Ufmylation and FATylation pathways are downregulated in human alcoholic and nonalcoholic steatohepatitis, and mice fed DDC, where Mallory-Denk bodies (MDBs) form.
24528925 2014 Investigations into the auto-FAT10ylation of the bispecific E2 conjugating enzyme UBA6-specific E2 enzyme 1.
24518302 2014 NF?B and STAT3 synergistically activate the expression of FAT10, a gene counteracting the tumor suppressor p53.
24492942 2014 Increased FAT10 expression is related to poor prognosis in pancreatic ductal adenocarcinoma.
24440736 2014 Recombinant adenovirus encoding FAT10 small interfering RNA inhibits HCC growth in vitro and in vivo.
24325913 2014 FAT10, an ubiquitin-like protein, confers malignant properties in non-tumorigenic and tumorigenic cells.
23862649 2014 A proteomics strategy for the identification of FAT10-modified sites by mass spectrometry.
23812429 2014 As an independent prognostic factor, FAT10 promotes hepatitis B virus-related hepatocellular carcinoma progression via Akt/GSK3? pathway.
23416168 2013 FAT10 protects cardiac myocytes against apoptosis.
23036196 2012 Modification of the inflammatory mediator LRRFIP2 by the ubiquitin-like protein FAT10 inhibits its activity during cellular response to LPS.
22797925 2012 The proteomic analysis of endogenous FAT10 substrates identifies p62/SQSTM1 as a substrate of FAT10ylation.
22569823 2012 Identification of a novel binding protein of FAT10: eukaryotic translation elongation factor 1A1.
22434192 2012 FAT10 and NUB1L bind to the VWA domain of Rpn10 and Rpn1 to enable proteasome-mediated proteolysis.
22427669 2012 Mechanistic studies on activation of ubiquitin and di-ubiquitin-like protein, FAT10, by ubiquitin-like modifier activating enzyme 6, Uba6.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22402871 2012 Increased expression of FAT10 is correlated with progression and prognosis of human glioma.
22349260 2012 The FAT10- and ubiquitin-dependent degradation machineries exhibit common and distinct requirements for MHC class I antigen presentation.
22347407 2012 The inherited blindness protein AIPL1 regulates the ubiquitin-like FAT10 pathway.
22292662 2011 Genetic variation in the Fat10 gene is associated with risk of hepatocellular carcinoma in a Chinese population.
22281738 2012 Structure of a compact conformation of linear diubiquitin.
22164771 2011 Vitexin inhibits polyubiquitin synthesis by the ubiquitin-conjugating enzyme E2-25K.
22072791 2012 FAT10 is a proteasomal degradation signal that is itself regulated by ubiquitination.
22025632 2011 FAT10 mediates the effect of TNF-? in inducing chromosomal instability.
21757738 2011 FAT10 protein binds to polyglutamine proteins and modulates their solubility.
21631897 2011 Replication and further characterization of a Type 1 diabetes-associated locus at the telomeric end of the major histocompatibility complex.
21396347 2011 FAT10 modifies p53 and upregulates its transcriptional activity.
21351261 2010 Polymorphisms in inflammatory pathway genes and their association with colorectal cancer risk.
21121635 2011 NMR reveals a different mode of binding of the Stam2 VHS domain to ubiquitin and diubiquitin.
20975683 2010 USE1 is a bispecific conjugating enzyme for ubiquitin and FAT10, which FAT10ylates itself in cis.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
19959714 2010 The ubiquitin-like protein FAT10 mediates NF-kappaB activation.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19808075 2010 A regulatory single nucleotide polymorphism in the ubiquitin D gene associated with celiac disease.
19726511 2009 FAT10: a novel mediator of Vpr-induced apoptosis in human immunodeficiency virus-associated nephropathy.
19437562 2009 FAT10 level in human gastric cancer and its relation with mutant p53 level, lymph node metastasis and TNM staging.
19303852 2009 Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation.
19185524 2009 Structural basis for recognition of diubiquitins by NEMO.
19166848 2009 Degradation of FAT10 by the 26S proteasome is independent of ubiquitylation but relies on NUB1L.
19033385 2008 The ubiquitin-like modifier FAT10 interacts with HDAC6 and localizes to aggresomes under proteasome inhibition.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18574467 2008 Proinflammatory cytokines cause FAT10 upregulation in cancers of liver and colon.
17971048 2008 SNP mapping and candidate gene sequencing in the class I region of the HLA complex: searching for multiple sclerosis susceptibility genes in Tasmanians.
17889673 2007 E1-L2 activates both ubiquitin and FAT10.
16959044 2006 FAT10, a gene up-regulated in various cancers, is cell-cycle regulated.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16707496 2006 The UBA domains of NUB1L are required for binding but not for accelerated degradation of the ubiquitin-like modifier FAT10.
16501612 2006 p53 negatively regulates the expression of FAT10, a gene upregulated in various cancers.
16495380 2006 Role of ubiquitin-like protein FAT10 in epithelial apoptosis in renal disease.
16495226 2006 FAT10 plays a role in the regulation of chromosomal stability.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15831455 2005 FAT10, a ubiquitin-independent signal for proteasomal degradation.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14757770 2004 NEDD8 ultimate buster-1L interacts with the ubiquitin-like protein FAT10 and accelerates its degradation.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12883554 2003 A non-proteolytic role for ubiquitin in Tat-mediated transactivation of the HIV-1 promoter.
12730673 2003 Expression of the FAT10 gene is highly upregulated in hepatocellular carcinoma and other gastrointestinal and gynecological cancers.
12610113 2003 Retroviruses have differing requirements for proteasome function in the budding process.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991975 2002 Late assembly domain function can exhibit context dependence and involves ubiquitin residues implicated in endocytosis.
11112487 2000 Ubiquitination of HIV-1 and MuLV Gag.
11087860 2000 A role for ubiquitin ligase recruitment in retrovirus release.
11087859 2000 Proteasome inhibition interferes with gag polyprotein processing, release, and maturation of HIV-1 and HIV-2.
10200259 1999 A MHC-encoded ubiquitin-like protein (FAT10) binds noncovalently to the spindle assembly checkpoint protein MAD2.
9525617 1998 Ubiquitin is covalently attached to the p6Gag proteins of human immunodeficiency virus type 1 and simian immunodeficiency virus and to the p12Gag protein of Moloney murine leukemia virus.
9368598 1997 Identification and analysis of a novel member of the ubiquitin family expressed in dendritic cells and mature B cells.
8662070 1996 Identification of seven new human MHC class I region genes around the HLA-F locus.