Property Summary

NCBI Gene PubMed Count 34
PubMed Score 216.40
PubTator Score 62.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 4.7e-02
osteosarcoma -2.857 1.5e-07
interstitial cystitis 1.200 1.2e-03
psoriasis 1.400 1.5e-32

Gene RIF (18)

PMID Text
25876712 A negative correlation was found between UBASH3A mRNA expression and systemic lupus erythematosus.
25843625 Findings suggest that UBASH3A gene might contribute to systemic lupus erythematosus susceptibility and influence the clinical phenotype of the disease.
25211447 these results have suggested that the allele A of two SNPs may play no role in the pathogenesis of autoimmune thyroid disease or that its effect may be confounded by other various factors.
25075402 Addition of PTPN22 and UBASH3A SNPs to HLA-DR,DQ genotyping can improve type 1 diabetes risk prediction.
23565265 Results suggest that UBASH3a gene plays a role in the susceptibility to systemic lupus erythematosus and UBASH3a can be considered as a common genetic factor in autoimmune diseases.
22776074 ubiquitin associated and SH3 domain containing A appears to be an independent predictor of islet autoimmunity and type 1 diabetes in children, including those free of family history of T1D but carrying the HLA-DR3/4,DQB1*0302 genotype
20647273 Observational study of gene-disease association. (HuGE Navigator)
20494980 The UBASH3A promoter is activated by serum depletion according to promoter reporter assays in HEK 293 cells.
20410501 Observational study of gene-disease association. (HuGE Navigator)
19073967 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of ubiquitin associated and SH3 domain containing A (UBASH3A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18840781 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18189269 TULA proteins TULA and TULA-2 regulate activity of the protein tyrosine kinase Syk
18006034 Binds to ABCE-1 and inhibits HIV-1 life cycle, most likely by disrupting essential ubiquitylation-dependent events.
18006034 Expression of TULA proteins reduces the production of HIV-1 particles and modulates Gag processing. ABCE1 recruits TULA to Gag
17709377 TULA enhances the apoptotic effect of AIF by facilitating the interactions of AIF with its apoptotic co-factors
17382318 TULA inhibits both clathrin-dependent and clathrin-independent endocytic pathways by functionally sequestering dynamin via the SH3 domain of TULA binding proline-rich sequences in dynamin
15159412 Sts-1 and Sts-2 bind to Cbl and inhibit endocytosis of receptor tyrosine kinases

AA Sequence

MAAGETQLYAKVSNKLKSRSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPI      1 - 70
PQEYALFLCPTGPLLEKLQEFWRESKRQCAKNRAHEVFPHVTLCDFFTCEDQKVECLYEALKRAGDRLLG     71 - 140
SFPTAVPLALHSSISYLGFFVSGSPADVIREFAMTFATEASLLAGTSVSRFWIFSQVPGHGPNLRLSNLT    141 - 210
RASFVSHYILQKYCSVKPCTKQLHLTLAHKFYPHHQRTLEQLARAIPLGHSCQWTAALYSRDMRFVHYQT    211 - 280
LRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRM    281 - 350
YTFSLATDLNSRKDGEASSRCSGEFLPQTARSLSSLQALQATVARKSVLVVRHGERVDQIFGKAWLQQCS    351 - 420
TPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPALRCVQTA    421 - 490
KLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNIDTDYRPAFPLSALMPAESYQE    491 - 560
YMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKE    561 - 630
EGKWELVNPPVKTLTHGANAAFNWRNWISGN                                           631 - 661
//

Text Mined References (36)

PMID Year Title
25876712 2015 Decreased UBASH3A mRNA Expression Levels in Peripheral Blood Mononuclear Cells from Patients with Systemic Lupus Erythematosus.
25843625 2015 Association of UBASH3A gene polymorphisms and systemic lupus erythematosus in a Chinese population.
25416956 2014 A proteome-scale map of the human interactome network.
25211447 2014 Lack of association between polymorphisms in the UBASH3A gene and autoimmune thyroid disease: a case control study.
25075402 2014 Improving prediction of type 1 diabetes by testing non-HLA genetic variants in addition to HLA markers.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23565265 2013 Evidence of new risk genetic factor to systemic lupus erythematosus: the UBASH3A gene.
22776074 2012 rs11203203 is associated with type 1 diabetes risk in population pre-screened for high-risk HLA-DR,DQ genotypes.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21383967 2011 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.
20647273 2010 Investigation of type 1 diabetes and coeliac disease susceptibility loci for association with juvenile idiopathic arthritis.
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
20410501 2010 Variant of TYR and autoimmunity susceptibility loci in generalized vitiligo.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19585081 2009 TULA-family proteins: an odd couple.
19430480 2009 Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes.
19073967 2008 Shared and distinct genetic variants in type 1 diabetes and celiac disease.
18840781 2009 Follow-up analysis of genome-wide association data identifies novel loci for type 1 diabetes.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18344182 2008 Multidomain STS/TULA proteins are novel cellular regulators.
18189269 2008 TULA proteins regulate activity of the protein tyrosine kinase Syk.
18006034 2008 TULA proteins bind to ABCE-1, a host factor of HIV-1 assembly, and inhibit HIV-1 biogenesis in a UBA-dependent fashion.
17880946 2007 Suppressor of T-cell receptor signalling 1 and 2 differentially regulate endocytosis and signalling of receptor tyrosine kinases.
17709377 2007 T-cell ubiquitin ligand affects cell death through a functional interaction with apoptosis-inducing factor, a key factor of caspase-independent apoptosis.
17382318 2007 The Cbl-interacting protein TULA inhibits dynamin-dependent endocytosis.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16429130 2006 Regulation of ubiquitin-binding proteins by monoubiquitination.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15159412 2004 Suppressors of T-cell receptor signaling Sts-1 and Sts-2 bind to Cbl and inhibit endocytosis of receptor tyrosine kinases.
15107835 2004 TULA: an SH3- and UBA-containing protein that binds to c-Cbl and ubiquitin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11281453 2001 Isolation and characterization of the UBASH3A gene on 21q22.3 encoding a potential nuclear protein with a novel combination of domains.
10830953 2000 The DNA sequence of human chromosome 21.