Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.45
PubTator Score 8.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
oligodendroglioma 1.100 4.5e-03
psoriasis -2.200 4.3e-04
osteosarcoma -1.347 1.3e-03
astrocytoma 1.400 7.1e-03
atypical teratoid / rhabdoid tumor 1.900 2.6e-09
glioblastoma 2.000 2.3e-09
medulloblastoma 1.500 6.7e-05
medulloblastoma, large-cell 2.000 1.1e-07
primitive neuroectodermal tumor 1.400 1.5e-05
intraductal papillary-mucinous adenoma (... 1.600 1.8e-03
intraductal papillary-mucinous carcinoma... 1.500 3.4e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.5e-02
colon cancer 1.200 2.9e-03
lung cancer 1.300 2.9e-03
pediatric high grade glioma 1.400 3.6e-06
inflammatory breast cancer 1.100 1.2e-03
invasive ductal carcinoma 1.200 5.6e-04
ovarian cancer 1.900 4.4e-07

Gene RIF (7)

PMID Text
26381755 arginine residues in the RGG/RG motif of UBAP2L were directly methylated by PRMT1. RGG/RG motif of UBAP2L is essential for the proper alignment of chromosomes.
26310274 These results suggest that UBAP2L has a key role in glioma cell growth, and may act as an oncogene to promote malignant glioma development.
25631074 Cellular biotinylated ubiquitin associated protein 2-like (UBAP2L) is incorporated into HIV-1 Gag virus-like particles
25185265 Two different BMI1-containing PcG complexes regulate hematopoietic stem cell activity, which are distinguishable by the presence of UBAP2L.
25069639 Knockdown of UBAP2L in prostate carcinoma inhibited cell proliferation, migration, and colony formation ability, and blocked cell cycle progression.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDITGKNQDECVI      1 - 70
ALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRR     71 - 140
GRGASRGREFRGQENGLDGTKSGGPSGRGTERGRRGRGRGRGGSGRRGGRFSAQGMGTFNPADYAEPANT    141 - 210
DDNYGNSSGNTWNNTGHFEPDDGTSAWRTATEEWGTEDWNEDLSETKIFTASNVSSVPLPAENVTITAGQ    211 - 280
RIDLAVLLGKTPSTMENDSSNLDPSQAPSLAQPLVFSNSKQTAISQPASGNTFSHHSMVSMLGKGFGDVG    281 - 350
EAKGGSTTGSQFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYDLKNPSDSAVHSPFTK    351 - 420
RQAFTPSSTMMEVFLQEKSPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKK    421 - 490
KASLTSKIPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSASSSQAPSSLYTSTASESSST    491 - 560
ISSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTRRYPSSISSSPQKDLTQAKNGFSSVQATQLQ    561 - 630
TTQSVEGATGSAVKSDSPSTSSIPPLNETVSAASLLTTTNQHSSSLGGLSHSEEIPNTTTTQHSSTLSTQ    631 - 700
QNTLSSSTSSGRTSTSTLLHTSVESEANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNS    701 - 770
TVTASTRSSVATTSGKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPFP    771 - 840
TPTTPLTGRDGSLASNPYSGDLTKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLNPALPPGYSYTS    841 - 910
LPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTGVSVTSSNTGVPD    911 - 980
ISGSVYSKTQQSFEKQGFHSGTPAASFNLPSALGSGGPINPATAAAYPPAPFMHILTPHQQPHSQILHHH    981 - 1050
LQQDGQTGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN                                    1051 - 1087
//

Text Mined References (39)

PMID Year Title
26381755 2016 Arginine methylation of ubiquitin-associated protein 2-like is required for the accurate distribution of chromosomes.
26310274 2015 Downregulation of ubiquitin-associated protein 2-like with a short hairpin RNA inhibits human glioma cell growth in vitro.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25185265 2014 UBAP2L is a novel BMI1-interacting protein essential for hematopoietic stem cell activity.
25069639 2014 Knockdown of ubiquitin associated protein 2-like inhibits the growth and migration of prostate cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19945174 2010 Identification of human sperm proteins that interact with human zona pellucida3 (ZP3) using yeast two-hybrid system.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18838386 2008 Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230159 2001 Identification of human epidermal differentiation complex (EDC)-encoded genes by subtractive hybridization of entire YACs to a gridded keratinocyte cDNA library.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.