Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary


No data available


AA Sequence

MGFQQDRIKEVLLVHGNRREQALEELVACAQ                                           351 - 381

Text Mined References (5)

PMID Year Title