Property Summary

NCBI Gene PubMed Count 22
PubMed Score 155.87
PubTator Score 18.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.600 2.1e-05
osteosarcoma -3.423 1.1e-09
medulloblastoma, large-cell -1.100 5.5e-03
lung cancer -1.100 2.4e-03
spina bifida -1.107 4.0e-02
acute myeloid leukemia 1.100 3.9e-03
ovarian cancer 1.400 3.6e-05

Gene RIF (9)

PMID Text
26317613 Physiological levels of Vpu requires the core ESCRT pathway (TSG1010 and UBAP1) and HGA (HRS) for Vpu-mediated BST-2 (tetherin) degradation but does not require these proteins for counteraction of BST2 (tetherin's) physical antiviral activity
24284069 The biochemical specificity in ESCRT-I assembly is matched by functional specialisation as siRNA-mediated depletion of UBAP1
22479182 Physiological levels of Vpu requires the core ESCRT pathway (TSG1010 and UBAP1) and HGA (HRS) for Vpu-mediated BST-2 (tetherin) degradation but does not require these proteins for counteraction of BST2 (tetherin's) physical antiviral activity
22405001 Physiological levels of Vpu requires the core ESCRT pathway (TSG1010 and UBAP1) and HGA (HRS) for Vpu-mediated BST-2 (tetherin) degradation but does not require these proteins for counteraction of BST2 (tetherin's) physical antiviral activity
21129243 The upregulation of ubap1 gene expression mainly and the downregulation of p16 gene expression mainly may simultaneously participate in the pathogenesis of acute leukemia.
20670673 Observational study of gene-disease association. (HuGE Navigator)
19217189 Our data for the first time identifies UBAP1 as a genetic risk factor for FTLD and suggests a mechanistic relationship between this protein and TDP-43.
16226037 Decreased expression of UBAP1 protein is a possible point of dysfunction along the pathogenesis pathway for nasopharyngeal carcinoma that may contribute to malignant transformation.
12451983 the identification of differential expression patterns of ubap1 in different tumors.

AA Sequence

MASKKLGADFHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEKKTIEWAEEIK      1 - 70
KIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHSTATMPPPINPILASLQHNSILTPTRVSSSAT     71 - 140
KQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRGGSGSVLQ    141 - 210
DEEVLASLERATLDFKPLHKPNGFITLPQLGNCEKMSLSSKVSLPPIPAVSNIKSLSFPKLDSDDSNQKT    211 - 280
AKLASTFHSTSCLRNGTFQNSLKPSTQSSASELNGHHTLGLSALNLDSGTEMPALTSSQMPSLSVLSVCT    281 - 350
EESSPPNTGPTVTPPNFSVSQVPNMPSCPQAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENI    351 - 420
EQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDN    421 - 490
ALEDLMARAGAS                                                              491 - 502
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24284069 2014 The molecular basis for selective assembly of the UBAP1-containing endosome-specific ESCRT-I complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22405001 2012 The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a SOUBA domain.
21757351 2011 UBAP1 is a component of an endosome-specific ESCRT-I complex that is essential for MVB sorting.
21129243 2010 [Expression of ubiquitin associated protein 1 gene and tumor-suppressor gene p16 in acute leukemia].
20670673 2010 Is KIF24 a genetic risk factor for Frontotemporal Lobar Degeneration?
19217189 2009 Ubiquitin associated protein 1 is a risk factor for frontotemporal lobar degeneration.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16226037 2006 Purification of novel UBAP1 protein and its decreased expression on nasopharyngeal carcinoma tissue microarray.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12451983 2002 [Identification of digital differential expression patterns of a novel human gene (UBAP1) by an expressed sequence tag strategy].
12050802 2001 Cloning and Expression Analysis of a Novel Gene, UBAP1, Possibly Involved in Ubiquitin Pathway.
11599797 2001 Isolation and characterization of a novel cDNA, UBAP1, derived from the tumor suppressor locus in human chromosome 9p21-22.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.