Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.95
PubTator Score 5.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Behcet Syndrome 20
Disease Target Count P-value
ovarian cancer 8297 1.4e-04
Disease Target Count Z-score Confidence
Crohn's disease 311 0.0 3.0
Skin cancer 451 0.0 3.0
Disease Target Count Z-score Confidence
Behcet's disease 87 4.921 2.5
Disease Target Count
Behcet's syndrome 49

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 1.4e-04

Protein-protein Interaction (8)

Gene RIF (3)

AA Sequence

MFTSTGSSGLYKAPLSKSLLLVPSALSLLLALLLPHCQKLFVYDLHAVKNDFQIWRLICGRIICLDLKDT      1 - 70
FCSSLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFLLIEAMQYFFGITAASNLPSGFLAPVFALFVP     71 - 140
FYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWM    141 - 210
AKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFP    211 - 280
PLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH          281 - 344
//

Text Mined References (14)

PMID Year Title