Property Summary

NCBI Gene PubMed Count 18
PubMed Score 410.02
PubTator Score 3.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.1e-06
Multiple myeloma 1332 4.4e-05
ovarian cancer 8520 9.6e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Acute cystitis 35 4.295 2.1
Pneumonia 174 3.256 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.141 4.4e-05
osteosarcoma -2.064 1.1e-06
ovarian cancer 1.500 9.6e-05

Gene RIF (1)

AA Sequence

MFVQEEKIFAGKVLRLHICASDGAEWLEEATEDTSVEKLKERCLKHCAHGSLEDPKSITHHKLIHAASER      1 - 70
VLSDARTILEENIQDQDVLLLIKKRAPSPLPKMADVSAEEKKKQDQKAPDKEAILRATANLPSYNMDRAA     71 - 140
VQTNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEDERVDEAALRQLTEMGFPENRA    141 - 210
TKALQLNHMSVPQAMEWLIEHAEDPTIDTPLPGQAPPEAEGATAAASEAAAGASATDEEARDELTEIFKK    211 - 280
IRRKREFRADARAVISLMEMGFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAI    281 - 350
LDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT                   351 - 405
//

Text Mined References (20)

PMID Year Title