Property Summary

NCBI Gene PubMed Count 30
PubMed Score 11.67
PubTator Score 13.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.245 7.6e-03
Multiple myeloma 1.081 1.5e-02
juvenile dermatomyositis 1.057 5.8e-08
Amyotrophic Lateral Sclerosis 1.111 2.2e-05
acute quadriplegic myopathy 1.001 1.4e-03
dermatomyositis 1.600 6.0e-03

Gene RIF (10)

PMID Text
25229838 E1 (NAE1 and UBA3) and E2 (UBC12) enzymes, as well as global NEDD8 conjugation, were upregulated in over 2/3 of human intrahepatic cholangiocarcinoma
24691136 The study demonstrated that two mutations in UBA3 which were not previously reported confer MLN4924 resistance to MLN4924, a selective NEDD8-activating enzyme inhibitor.
24525735 Report role for neddylation via Nedd8-activating enzyme in the regulation of tumor angiogenesis.
22821745 Demonstrated that Uba3-betaGD is an independently folded domain in solution and that residues involved in E2 binding are absent from the NMR spectrum, indicating that the E2-binding surface on Uba3-betaGD interconverts between multiple conformations.
22404213 Knockdown of ubiquitin-like modifier activating enzyme 3 (UBA3) by siRNA inhibits HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
18652489 X-ray crystallographic analysis of APPBP1-UBA3-NEDD8 shows that APPBP1-UBA3's preference for NEDD8's Ala72 appears to be indirect, due to proper positioning of UBA3's Arg190.
15694336 crystal structure of a complex between the C-terminal domain from NEDD8's heterodimeric E1 (APPBP1-UBA3) and the catalytic core domain of NEDD8's E2 (Ubc12)
14690597 Data report the structure of the quaternary complex between human APPBP1-UBA3, a heterodimeric E1, its ubl NEDD8, and ATP.
12740388 Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer.
12646924 structure and mutational analysis of human APPBP1-UBA3, the heterodimeric E1 enzyme for NEDD8

AA Sequence

MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTC      1 - 70
KVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCN     71 - 140
VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNA    141 - 210
RVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQW    211 - 280
IFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDG    281 - 350
LYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTS    351 - 420
IEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS                               421 - 463
//

Text Mined References (33)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25229838 2014 Neddylation pathway is up-regulated in human intrahepatic cholangiocarcinoma and serves as a potential therapeutic target.
24691136 2014 Mutations in UBA3 confer resistance to the NEDD8-activating enzyme inhibitor MLN4924 in human leukemic cells.
24525735 2014 Suppression of tumor angiogenesis by targeting the protein neddylation pathway.
22821745 2012 E2-binding surface on Uba3 ?-grasp domain undergoes a conformational transition.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19250909 2009 E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification.
18652489 2008 Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16712842 2006 Evidence for distinct functions for human DNA repair factors hHR23A and hHR23B.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16620772 2006 A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers.
16503656 2006 Analysis of Nedd8-associated polypeptides: a model for deciphering the pathway for ubiquitin-like modifications.
16400609 2006 Single-nucleotide polymorphisms in NAGNAG acceptors are highly predictive for variations of alternative splicing.
16381901 2006 The LIFEdb database in 2006.
15694336 2005 Structural basis for recruitment of Ubc12 by an E2 binding domain in NEDD8's E1.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361859 2004 A unique E1-E2 interaction required for optimal conjugation of the ubiquitin-like protein NEDD8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690597 2003 The structure of the APPBP1-UBA3-NEDD8-ATP complex reveals the basis for selective ubiquitin-like protein activation by an E1.
12740388 2003 Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer.
12646924 2003 Insights into the ubiquitin transfer cascade from the structure of the activating enzyme for NEDD8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10722740 2000 The amyloid precursor protein-binding protein APP-BP1 drives the cell cycle through the S-M checkpoint and causes apoptosis in neurons.
10409428 1999 Gene expression in proliferating human erythroid cells.
10207026 1999 Identification of the activating and conjugating enzymes of the NEDD8 conjugation pathway.
9694792 1998 A new NEDD8-ligating system for cullin-4A.