Property Summary

NCBI Gene PubMed Count 31
PubMed Score 26.63
PubTator Score 25.76

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.4e-08
medulloblastoma 1.200 2.5e-08
medulloblastoma, large-cell 1.400 5.3e-06

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
485374 confirmatory 69 / 0 / 12 SAR analysis of small molecule inhibitors of SUMOylation in an AlphaScreen assay
485391 confirmatory 67 / 0 / 21 SAR analysis of small molecule inhibitors of SUMOylation in an AlphaScreen assay in the presence of BSA
488777 confirmatory 5 / 0 / 33 SAR Analysis of interference of small molecule inhibitors of SUMOylation in an AlphaScreen assay

Gene RIF (8)

PMID Text
24318982 Here, we show that hHR23A utilizes both the UBA2 and XPCB domains to form a stable complex with Vpr, linking Vpr directly to cellular DNA repair pathways and their probable exploitation by the virus.
23095757 This study has identified the mechanism used to localize SAE to the nucleus.
22884621 Data indicate the role of anti-SUMO activating enzyme SAE1 and SAE2 antibody as marker of dermatomyositis.
22403398 Data show that the SAE2 subunit of the small ubiquitin-like modifier (SUMO) E1 is autoSUMOylated at residue Lys-236, and SUMOylation was catalyzed by Ubc9 at several additional Lys residues surrounding the catalytic Cys-173 of SAE2.
22157079 loss of SAE1/2 activity drives synthetic lethality with Myc; inactivation of SAE2 leads to mitotic catastrophe and cell death upon Myc hyperactivation; findings in Myc-high breast cancers suggest low tumor SAE1 and SAE2 correlates metastasis-free survival
21209321 The mammalian E1 subunits can be imported separately, identify nuclear localization signals (NLSs) in Aos1 and in Uba2, and demonstrate that their import is mediated by importin alpha/beta in vitro and in intact cells.
18680593 UBA2 stabilizes APOBEC3G by preventing ubiquitin chain elongation and proteasome-mediated proteolysis.
15660128 structures of heterodimeric Sae1/Sae2-Mg.ATP and Sae1/Sae2-SUMO-1-Mg.ATP complexes

AA Sequence

MALSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGR      1 - 70
SKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESG     71 - 140
TAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDR    141 - 210
ADPEAAWEPTEAEARARASNEDGDIKRISTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPV    211 - 280
PLDWAEVQSQGEETNASDQQNEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPS    281 - 350
AMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNK    351 - 420
QPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTIL    421 - 490
ISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAE    491 - 560
DAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNNADVSEEERSRKRKLDEKENLSAKRSRIEQK    561 - 630
EELDDVIALD                                                                631 - 640
//

Text Mined References (43)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24318982 2014 Binding of HIV-1 Vpr protein to the human homolog of the yeast DNA repair protein RAD23 (hHR23A) requires its xeroderma pigmentosum complementation group C binding (XPCB) domain as well as the ubiquitin-associated 2 (UBA2) domain.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23095757 2012 Sumoylation of SAE2 C terminus regulates SAE nuclear localization.
22884621 2012 Anti-SAE antibodies in autoimmune myositis: identification by unlabelled protein immunoprecipitation in an Italian patient cohort.
22403398 2012 Small ubiquitin-like modifier (SUMO) modification of E1 Cys domain inhibits E1 Cys domain enzymatic activity.
22157079 2012 A SUMOylation-dependent transcriptional subprogram is required for Myc-driven tumorigenesis.
21968017 2011 Ribosomal protein S3 is stabilized by sumoylation.
21269460 2011 Initial characterization of the human central proteome.
21209321 2011 Importin ?/? mediates nuclear import of individual SUMO E1 subunits and of the holo-enzyme.
20164921 2010 Active site remodelling accompanies thioester bond formation in the SUMO E1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19443651 2009 Conformational transition associated with E1-E2 interaction in small ubiquitin-like modifications.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18680593 2008 APOBEC3G-UBA2 fusion as a potential strategy for stable expression of APOBEC3G and inhibition of HIV-1 replication.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17643372 2007 The intrinsic affinity between E2 and the Cys domain of E1 in ubiquitin-like modifications.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16679534 2006 CGI-55 interacts with nuclear proteins and co-localizes to p80-coilin positive-coiled bodies in the nucleus.
16620772 2006 A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers.
16455490 2006 Regulation of SUMOylation by reversible oxidation of SUMO conjugating enzymes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15983381 2005 Interaction of DJ-1 with Daxx inhibits apoptosis signal-regulating kinase 1 activity and cell death.
15660128 2005 Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12941704 2003 Endonucleolytic processing of CCA-less tRNA precursors by RNase Z in Bacillus subtilis.
12924945 2003 Role of an N-terminal site of Ubc9 in SUMO-1, -2, and -3 binding and conjugation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11481243 2001 Expression and regulation of the mammalian SUMO-1 E1 enzyme.
11451954 2001 Polymeric chains of SUMO-2 and SUMO-3 are conjugated to protein substrates by SAE1/SAE2 and Ubc9.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10217437 1999 Molecular cloning and characterization of human AOS1 and UBA2, components of the sentrin-activating enzyme complex.
10187858 1999 Identification of the enzyme required for activation of the small ubiquitin-like protein SUMO-1.
9920803 1999 In vitro SUMO-1 modification requires two enzymatic steps, E1 and E2.
9853615 1998 Selection system for genes encoding nuclear-targeted proteins.