Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.11
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical adenoma 1.008 3.8e-03
glioblastoma 1.200 3.9e-05
group 3 medulloblastoma 1.200 8.9e-03
pediatric high grade glioma 1.200 3.0e-03
subependymal giant cell astrocytoma 1.422 2.2e-02
tuberculosis 1.300 2.0e-05

AA Sequence

MASEQDVRARLQRAGQEHLLRFWAELAPEPRAALLAELALLEPEALREHCRRAAEACARPHGPPPDLAAR      1 - 70
LRPLPPERVGRASRSDPETRRRWEEEGFRQISLNKVAVLLLAGGQGTRLGVTYPKGMYRVGLPSRKTLYQ     71 - 140
LQAERIRRVEQLAGERHGTRCTVPWYVMTSEFTLGPTAEFFREHNFFHLDPANVVMFEQRLLPAVTFDGK    141 - 210
VILERKDKVAMAPDGNGGLYCALEDHKILEDMERRGVEFVHVYCVDNILVRLADPVFIGFCVLQGADCGA    211 - 280
KVVEKAYPEEPVGVVCQVDGVPQVVEYSEISPETAQLRASDGSLLYNAGNICNHFFTRGFLKAVTREFEP    281 - 350
LLKPHVAVKKVPYVDEEGNLVKPLKPNGIKMEKFVFDVFRFAKNFAALEVLREEEFSPLKNAEPADRDSP    351 - 420
RTARQALLTQHYRWALRAGARFLDAHGAWLPELPSLPPNGDPPAICEISPLVSYSGEGLEVYLQGREFQS    421 - 490
PLILDEDQAREPQLQES                                                         491 - 507
//

Text Mined References (6)

PMID Year Title