Property Summary

NCBI Gene PubMed Count 13
PubMed Score 184.29
PubTator Score 32.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.513 4.0e-03
astrocytic glioma -1.100 4.2e-02
psoriasis -1.200 1.6e-08
adrenocortical carcinoma -1.136 6.8e-04
tuberculosis and treatment for 3 months -1.300 2.6e-04
pancreatic ductal adenocarcinoma liver m... -2.093 1.2e-02
intraductal papillary-mucinous adenoma (... 1.200 6.7e-03
group 3 medulloblastoma 1.100 1.2e-02
invasive ductal carcinoma -1.041 3.3e-02
spina bifida -2.180 3.2e-02
ovarian cancer 3.100 8.2e-07

Gene RIF (3)

PMID Text
25241896 Results identified an enzyme, UAP1, which is highly overexpressed in prostate cancer and protects cancer cells from endoplasmic reticulum stress conferring a growth advantage.
19536175 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of UDP-N-acteylglucosamine pyrophosphorylase 1 (UAP1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MNINDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSHQKNVDARME      1 - 70
PVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQA     71 - 140
ERILKLQQVAEKYYGNKCIIPWYIMTSGRTMESTKEFFTKHKYFGLKKENVIFFQQGMLPAMSFDGKIIL    141 - 210
EEKNKVSMAPDGNGGLYRALAAQNIVEDMEQRGIWSIHVYCVDNILVKVADPRFIGFCIQKGADCGAKVV    211 - 280
EKTNPTEPVGVVCRVDGVYQVVEYSEISLATAQKRSSDGRLLFNAGNIANHFFTVPFLRDVVNVYEPQLQ    281 - 350
HHVAQKKIPYVDTQGQLIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLREDEFSPLKNADSQNGKDNPTT    351 - 420
ARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRSATNGKSETITADVNHNLKDANDVPIQCEISPLISYA    421 - 490
GEGLESYVADKEFHAPLIIDENGVHELVKNGI                                          491 - 522
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25241896 2015 UAP1 is overexpressed in prostate cancer and is protective against inhibitors of N-linked glycosylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707391 2001 Crystal structures of two human pyrophosphorylase isoforms in complexes with UDPGlc(Gal)NAc: role of the alternatively spliced insert in the enzyme oligomeric assembly and active site architecture.
9765219 1998 A 17-amino acid insert changes UDP-N-acetylhexosamine pyrophosphorylase specificity from UDP-GalNAc to UDP-GlcNAc.
9621304 1998 Expression of the human antigen SPAG2 in the testis and localization to the outer dense fibers in spermatozoa.
9603950 1998 The eukaryotic UDP-N-acetylglucosamine pyrophosphorylases. Gene cloning, protein expression, and catalytic mechanism.
8025165 1994 Characterization of a human antigen with sera from infertile patients.