Property Summary

NCBI Gene PubMed Count 24
PubMed Score 17.05
PubTator Score 6.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.400 9.0e-04
Breast cancer 2.200 2.9e-02
cystic fibrosis -1.156 9.4e-05
ependymoma 1.300 1.2e-05
glioblastoma 1.200 2.9e-04
invasive ductal carcinoma -1.100 2.7e-02
lung adenocarcinoma -1.100 1.6e-11
medulloblastoma 1.300 1.0e-02
non-small cell lung carcinoma -1.200 1.1e-24
osteosarcoma 1.811 3.0e-06
ovarian cancer 2.100 1.5e-06
pancreatic cancer 1.400 3.2e-03
pancreatic ductal adenocarcinoma liver m... 1.193 7.3e-04
pediatric high grade glioma 1.100 2.2e-03
primitive neuroectodermal tumor 1.300 1.6e-03
progressive supranuclear palsy -1.600 7.7e-03
tuberculosis 1.200 6.0e-05

Gene RIF (5)

AA Sequence

MKSLKSRLRRQDVPGPASSGAAAASAHAADWNKYDDRLMKAAERGDVEKVTSILAKKGVNPGKLDVEGRS      1 - 70
VFHVVTSKGNLECLNAILIHGVDITTSDTAGRNALHLAAKYGHALCLQKLLQYNCPTEHADLQGRTALHD     71 - 140
AAMADCPSSIQLLCDHGASVNAKDVDGRTPLVLATQMSRPTICQLLIDRGADVNSRDKQNRTALMLGCEY    141 - 210
GCRDAVEVLIKNGADISLLDALGHDSSYYARIGDNLDILTLLKTASENTNKGRELWKKGPSLQQRNLTHM    211 - 280
QDEVNVKSHQREHQNIQDLEIENEDLKERLRKIQQEQRILLDKVNGLQLQLNEEVMVADDLESEREKLKS    281 - 350
LLAAKEKQHEESLRTIEALKNRFKYFESDHLGSGSHFSNRKEDMLLKQGQMYMADSQCTSPGIPAHMQSR    351 - 420
SMLRPLELSLPSQTSYSENEILKKELEAMRTFCESAKQDRLKLQNELAHKVAECKALALECERVKEDSDE    421 - 490
QIKQLEDALKDVQKRMYESEGKVKQMQTHFLALKEHLTSEAASGNHRLTEELKDQLKDLKVKYEGASAEV    491 - 560
GKLRNQIKQNEMIVEEFKRDEGKLIEENKRLQKELSMCEMEREKKGRKVTEMEGQAKELSAKLALSIPAE    561 - 630
KFENMKSSLSNEVNEKAKKLVEMEREHEKSLSEIRQLKRELENVKAKLAQHVKPEEHEQVKSRLEQKSGE    631 - 700
LGKKITELTLKNQTLQKEIEKVYLDNKLLKEQAHNLTIEMKNHYVPLKVSEDMKKSHDAIIDDLNRKLLD    701 - 770
VTQKYTEKKLEMEKLLLENDSLSKDVSRLETVFVPPEKHEKEIIALKSNIVELKKQLSELKKKCGEDQEK    771 - 840
IHALTSENTNLKKMMSNQYVPVKTHEEVKMTLNDTLAKTNRELLDVKKKFEDINQEFVKIKDKNEILKRN    841 - 910
LENTQNQIKAEYISLAEHEAKMSSLSQSMRKVQDSNAEILANYRKGQEEIVTLHAEIKAQKKELDTIQEC    911 - 980
IKVKYAPIVSFEECERKFKATEKELKDQLSEQTQKYSVSEEEVKKNKQENDKLKKEIFTLQKDLRDKTVL    981 - 1050
IEKSHEMERALSRKTDELNKQLKDLSQKYTEVKNVKEKLVEENAKQTSEILAVQNLLQKQHVPLEQVEAL   1051 - 1120
KKSLNGTIENLKEELKSMQRCYEKEQQTVTKLHQLLENQKNSSVPLAEHLQIKEAFEKEVGIIKASLREK   1121 - 1190
EEESQNKMEEVSKLQSEVQNTKQALKKLETREVVDLSKYKATKSDLETQISSLNEKLANLNRKYEEVCEE   1191 - 1260
VLHAKKKEISAKDEKELLHFSIEQEIKDQKERCDKSLTTITELQRRIQESAKQIEAKDNKITELLNDVER   1261 - 1330
LKQALNGLSQLTYTSGNPTKRQSQLIDTLQHQVKSLEQQLADADRQHQEVIAIYRTHLLSAAQGHMDEDV   1331 - 1400
QEALLQIIQMRQGLVC                                                         1401 - 1416
//

Text Mined References (30)

PMID Year Title