Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
18630988 iGb3 is unlikely to represent natural ligand for NKT cells in humans. Furthermore, the absence of iGb3 in humans implies that it is another source of foreign Galalpha(1,3)Gal xenoantigen, with obvious significance in the field of xenotransplantation.

AA Sequence

MALKEGLRAWKRIFWRQILLTLGLLGLFLYGLPKFRHLEALIPMGVCPSATMSQLRDNFTGALRPWARPE      1 - 70
VLTCTPWGAPIIWDGSFDPDVAKQEARQQNLTIGLTIFAVGRYLEKYLERFLETAEQHFMAGQSVMYYVF     71 - 140
TELPGAVPRVALGPGRRLPVERVARERRWQDVSMARMRTLHAALGGLPGREAHFMFCMDVDQHFSGTFGP    141 - 210
EALAESVAQLHSWHYHWPSWLLPFERDAHSAAAMAWGQGDFYNHAAVFGGSVAALRGLTAHCAGGLDWDR    211 - 280
ARGLEARWHDESHLNKFFWLHKPAKVLSPEFCWSPDIGPRAEIRRPRLLWAPKGYRLLRN              281 - 340
//

Text Mined References (3)

PMID Year Title
23378701 2013 Lack of iGb3 and Isoglobo-Series Glycosphingolipids in Pig Organs Used for Xenotransplantation: Implications for Natural Killer T-Cell Biology.
18630988 2008 Humans lack iGb3 due to the absence of functional iGb3-synthase: implications for NKT cell development and transplantation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.