Property Summary

NCBI Gene PubMed Count 96
PubMed Score 120.01
PubTator Score 123.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.200 4.4e-03
group 4 medulloblastoma 1.300 1.3e-05
astrocytoma 1.500 6.3e-03
medulloblastoma, large-cell 1.200 6.6e-04
lung cancer 1.200 1.8e-03
adult high grade glioma -1.100 9.1e-04
ovarian cancer 1.400 2.1e-04

Gene RIF (40)

PMID Text
26952537 The U2AF(65) linker residues between the dual RNA recognition motifs (RRMs) recognize the central nucleotide, whereas the N- and C-terminal RRM extensions recognize the 3' terminus and third nucleotide.
26687686 Serum RNU2-1f may serve as a biomarker for lung cancer detection, prognosis prediction and treatment monitoring.
26218986 Nuclear retention of full-length HTT RNA is mediated by splicing factors MBNL1 and U2AF65
26216990 U2AF(65) possesses a splicing Inhibitory function that leads to alternative exon skipping.
25605964 We demonstrated that PRPF40B interacts directly with SF1 and associates with U2AF(65
25422459 reduced U2AF(65) binding is a molecular consequence of disease-relevant mutations, and a structure-guided U2AF(65) variant is capable of manipulating gene expression in eukaryotic cells
25326705 U2AF has the capacity to directly define ~88% of functional 3' splice sites in the human genome; numerous U2AF binding events also occur in intronic locations.
24734879 The spatial distribution of U2AF65 conformations is found to be highly anisotropic, comprising significantly populated interdomain contacts that appear to be electrostatic in origin.
24389012 U2AF65 represents a new route for modulating TRF1 function at telomeres.
23376934 The results highlight both local and global conformational selection as a means for universal 3' splice site recognition by U2AF65.
23374342 By preventing U2AF65 binding to Alu elements, hnRNP C plays a critical role as a genome-wide sentinel protecting the transcriptome.
23273425 The conserved SPSP motif phosphorylation and the SF1/U2AF interface are essential in vivo.
23166591 Expression of HIV-1 Tat upregulates the abundance of U2 small nuclear RNA auxiliary factor 2 (U2AF2) in the nucleoli of Jurkat T-cells
23017209 RBM5 promotes exon 4 skipping of AID pre-mRNA by competing with the binding of U2AF65 to the polypyrimidine tract.
22792276 The REST N exon is a very versatile sequence with a complex array of splicing signals, and its activation in H69 cells depends on the relative amounts of hnRNP H and U2AF65.
22702716 These complementary structural methods demonstrate that diverse splice sites have the opportunity to select compact or extended inter-RRM proximities from the U2AF65 conformational pool
22325350 hnRNP A1 forms a ternary complex with the U2AF heterodimer on AG-containing/uridine-rich RNAs, while it displaces U2AF from non-AG-containing/uridine-rich RNAs, an activity that requires the glycine-rich domain of hnRNP A1
21835928 dephosphorylation of pS776-ATXN1 by PP2A regulates the interaction of ATXN1 with the splicing factors RBM17 and U2AF65
21753750 the molecular mechanisms of the recognition of the 3'-splice-site-associated polypyrimidine tract RNA by the large subunit of the human U2 snRNP auxiliary factor (U2AF65) as a key early step in pre-mRNA splicing
21725067 The U2AF65 protein served as an adaptor to link expanded CAG RNA to NXF1 for RNA export.
21536736 U2AF65 binds directly to the phosphorylated C-terminal domain, and that this interaction results in increased recruitment of U2AF65 and PRP19C to the pre-mRNA
21146534 the conformational changes that are induced by assembly of the SF1/U2AF(65)/RNA complex serve to position the pre-mRNA splice site optimally for subsequent stages of splicing.
19574390 study reveals the splicing factor U2AF65 undergoes posttranslational lysyl-5-hydroxylation catalyzed by Jmjd6
19244360 Collectively, the results suggest that both U2AF binding and other steps of U2 snRNP recruitment can be control points in SMN splicing regulation.
18974054 Puf60-UHM binds to ULM sequences in the splicing factors SF1, U2AF65, and SF3b155.
18842594 Solution conformation and thermodynamic characteristics of RNA binding by the splicing factor U2AF65.
18508922 there is a functional link among apoptosis induction, U2AF65 cleavage, and the regulation of Fas alternative splicing
18285458 SF1 and U2AF form extraspliceosomal complexes before and after taking part in the assembly of catalytic spliceosomes.
17188295 This rare, high-resolution view of an important member of the RNA recognition motifs class of RNA-binding domains highlights the role of alternative side-chain conformations in RNA recognition.
17137510 U2AF65 associates with specific subsets of spliced mRNAs, strongly suggesting that it is involved in novel cellular functions in addition to splicing.
17024186 a direct role of the U2AF 65/CF I(m) 59 interaction in the functional coordination of splicing and 3' end processing.
16940179 Results describe the roles of the two subunits of U2AF, U2AF65 and 35, in the selection between alternative 3' splice sites associated with polypyrimidine tracts of different strengths.
16809543 DEK enforces 3' splice site discrimination by U2AF; DEK phosphorylated at serines 19 and 32 associates with U2AF35, facilitates the U2AF35-AG interaction and prevents binding of U2AF65 to pyrimidine tracts not followed by AG
16682775 Cocrystals of a U2AF65 variant with a deoxyuridine dodecamer diffract X-rays to 2.9 angstroms resolution and contain one complex per asymmetric unit.
16376933 Multiple U2AF65 binding sites within SF3b155 regulate conformational rearrangements during spliceosome assembly.
16043505 identified and spatially localized sites of direct interaction between U2AF35 and U2AF65 in vivo in live cell nuclei.
15694343 two members of the U2AF65 family of proteins, hCC1.3, which we call CAPERalpha, and a related protein, CAPERbeta, regulate both steroid hormone receptor-mediated transcription and alternative splicing
14576315 U2AF65 modulates the function of the PLE (poly(A)-limiting element)
12297299 U2AF35 RRM is unstructured in solution but its tertiary structure is induced upon binding to U2AF65.
12189174 U2AF 65 promotes 3'-end processing, which contributes to 3'-terminal exon definition in RNA splicing

AA Sequence

MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRRRSKPLTRGAK      1 - 70
EEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVV     71 - 140
GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQ    141 - 210
AMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLT    211 - 280
SFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPST    281 - 350
INQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRP    351 - 420
VDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW                   421 - 475
//

Text Mined References (111)

PMID Year Title
26952537 2016 An extended U2AF(65)-RNA-binding domain recognizes the 3' splice site signal.
26687686 2016 Circulating U2 small nuclear RNA fragments as a diagnostic and prognostic biomarker in lung cancer patients.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26218986 2015 Nuclear retention of full-length HTT RNA is mediated by splicing factors MBNL1 and U2AF65.
26216990 2015 Splicing inhibition of U2AF65 leads to alternative exon skipping.
25605964 2015 Prp40 pre-mRNA processing factor 40 homolog B (PRPF40B) associates with SF1 and U2AF65 and modulates alternative pre-mRNA splicing in vivo.
25422459 2014 Structure-guided U2AF65 variant improves recognition and splicing of a defective pre-mRNA.
25416956 2014 A proteome-scale map of the human interactome network.
25326705 2014 Mechanisms for U2AF to define 3' splice sites and regulate alternative splicing in the human genome.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
24734879 2014 Transient electrostatic interactions dominate the conformational equilibrium sampled by multidomain splicing factor U2AF65: a combined NMR and SAXS study.
24389012 2014 The splicing factor U2AF65 stabilizes TRF1 protein by inhibiting its ubiquitin-dependent proteolysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23376934 2013 U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
23374342 2013 Direct competition between hnRNP C and U2AF65 protects the transcriptome from the exonization of Alu elements.
23273425 2013 Structure of phosphorylated SF1 bound to U2AF?? in an essential splicing factor complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23017209 2012 RBM5 promotes exon 4 skipping of AID pre-mRNA by competing with the binding of U2AF65 to the polypyrimidine tract.
22905162 2012 The MUC1 extracellular domain subunit is found in nuclear speckles and associates with spliceosomes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22792276 2012 Binding of hnRNP H and U2AF65 to respective G-codes and a poly-uridine tract collaborate in the N50-5'ss selection of the REST N exon in H69 cells.
22702716 2012 A Broad range of conformations contribute to the solution ensemble of the essential splicing factor U2AF(65).
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22569250 2012 Tumor suppressor RBM5 directly interacts with the DExD/H-box protein DHX15 and stimulates its helicase activity.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22325350 2012 hnRNP A1 proofreads 3' splice site recognition by U2AF.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21984414 2012 The RNA recognition motif protein RBM11 is a novel tissue-specific splicing regulator.
21835928 2011 14-3-3 Binding to ataxin-1(ATXN1) regulates its dephosphorylation at Ser-776 and transport to the nucleus.
21753750 2011 Multi-domain conformational selection underlies pre-mRNA splicing regulation by U2AF.
21725067 2011 Perturbation of U2AF65/NXF1-mediated RNA nuclear export enhances RNA toxicity in polyQ diseases.
21536736 2011 The RNA polymerase II C-terminal domain promotes splicing activation through recruitment of a U2AF65-Prp19 complex.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21460037 2011 SKIP counteracts p53-mediated apoptosis via selective regulation of p21Cip1 mRNA splicing.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21146534 2011 RNA induces conformational changes in the SF1/U2AF65 splicing factor complex.
20696395 2010 Conserved beta-hairpin recognition by the GYF domains of Smy2 and GIGYF2 in mRNA surveillance and vesicular transport complexes.
20467437 2010 Direct interaction between hnRNP-M and CDC5L/PLRG1 proteins affects alternative splice site choice.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19574390 2009 Jmjd6 catalyses lysyl-hydroxylation of U2AF65, a protein associated with RNA splicing.
19470458 2009 The protein factors MBNL1 and U2AF65 bind alternative RNA structures to regulate splicing.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19244360 2009 Differential 3' splice site recognition of SMN1 and SMN2 transcripts by U2AF and U2 snRNP.
18974054 2009 Dimerization and protein binding specificity of the U2AF homology motif of the splicing factor Puf60.
18951082 2008 Death by splicing: tumor suppressor RBM5 freezes splice-site pairing.
18842594 2008 Solution conformation and thermodynamic characteristics of RNA binding by the splicing factor U2AF65.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18508922 2008 Fas splicing regulation during early apoptosis is linked to caspase-mediated cleavage of U2AF65.
18285458 2008 Splicing factors SF1 and U2AF associate in extraspliceosomal complexes.
17589525 2007 U2AF-homology motif interactions are required for alternative splicing regulation by SPF45.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17188295 2007 Alternative conformations at the RNA-binding surface of the N-terminal U2AF(65) RNA recognition motif.
17137510 2006 Genome-wide identification of functionally distinct subsets of cellular mRNAs associated with two nucleocytoplasmic-shuttling mammalian splicing factors.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17024186 2006 An interaction between U2AF 65 and CF I(m) links the splicing and 3' end processing machineries.
16940179 2006 In vivo requirement of the small subunit of U2AF for recognition of a weak 3' splice site.
16809543 2006 Intron removal requires proofreading of U2AF/3' splice site recognition by DEK.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16682775 2006 Crystallization and preliminary X-ray analysis of a U2AF65 variant in complex with a polypyrimidine-tract analogue by use of protein engineering.
16376933 2006 Multiple U2AF65 binding sites within SF3b155: thermodynamic and spectroscopic characterization of protein-protein interactions among pre-mRNA splicing factors.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
16043505 2005 FRET analyses of the U2AF complex localize the U2AF35/U2AF65 interaction in vivo and reveal a novel self-interaction of U2AF35.
15694343 2005 Steroid hormone receptor coactivation and alternative RNA splicing by U2AF65-related proteins CAPERalpha and CAPERbeta.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456888 2004 The WW domain-containing proteins interact with the early spliceosome and participate in pre-mRNA splicing in vivo.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15009664 2004 Tau exon 10, whose missplicing causes frontotemporal dementia, is regulated by an intricate interplay of cis elements and trans factors.
14576315 2003 U2AF modulates poly(A) length control by the poly(A)-limiting element.
12718882 2003 Structural basis for the molecular recognition between human splicing factors U2AF65 and SF1/mBBP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456665 2002 A novel function for human factor C1 (HCF-1), a host protein required for herpes simplex virus infection, in pre-mRNA splicing.
12403470 2002 PSF and p54nrb bind a conserved stem in U5 snRNA.
12297299 2002 Induced folding of the U2AF35 RRM upon binding to U2AF65.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12189174 2002 A novel function for the U2AF 65 splicing factor in promoting pre-mRNA 3'-end processing.
12176931 2002 Large-scale proteomic analysis of the human spliceosome.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11551507 2001 A novel peptide recognition mode revealed by the X-ray structure of a core U2AF35/U2AF65 heterodimer.
11118443 2001 Nucleocytoplasmic shuttling of heterodimeric splicing factor U2AF.
11060040 2000 Human pre-mRNA cleavage factor II(m) contains homologs of yeast proteins and bridges two other cleavage factors.
10866799 2000 A trans-acting factor, isolated by the three-hybrid system, that influences alternative splicing of the amyloid precursor protein minigene.
10593950 1999 Presence of WT1, the Wilm's tumor suppressor gene product, in nuclear poly(A)(+) ribonucleoprotein.
10449420 1999 Phosphorylation of splicing factor SF1 on Ser20 by cGMP-dependent protein kinase regulates spliceosome assembly.
10449418 1999 Solution structures of the first and second RNA-binding domains of human U2 small nuclear ribonucleoprotein particle auxiliary factor (U2AF(65)).
9784496 1998 WT1 interacts with the splicing factor U2AF65 in an isoform-dependent manner and can be incorporated into spliceosomes.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
9645944 1998 Functional association of nuclear protein 4.1 with pre-mRNA splicing factors.
9512519 1998 A cooperative interaction between U2AF65 and mBBP/SF1 facilitates branchpoint region recognition.
9472028 1998 SRPK2: a differentially expressed SR protein-specific kinase involved in mediating the interaction and localization of pre-mRNA splicing factors in mammalian cells.
9447963 1998 Sip1, a novel RS domain-containing protein essential for pre-mRNA splicing.
9237760 1997 A protein related to splicing factor U2AF35 that interacts with U2AF65 and SR proteins in splicing of pre-mRNA.
9150140 1997 Cross-intron bridging interactions in the yeast commitment complex are conserved in mammals.
9016565 1997 Association of U2 snRNP with the spliceosomal complex E.
8816452 1996 Functional properties of p54, a novel SR protein active in constitutive and alternative splicing.
8647433 1996 The splicing factor U2AF35 mediates critical protein-protein interactions in constitutive and enhancer-dependent splicing.
2531895 1989 Identification, purification, and biochemical characterization of U2 small nuclear ribonucleoprotein auxiliary factor.
1824937 1991 Biochemical characterization of U2 snRNP auxiliary factor: an essential pre-mRNA splicing factor with a novel intranuclear distribution.
1538748 1992 Cloning and domain structure of the mammalian splicing factor U2AF.
1388271 1992 Cloning and intracellular localization of the U2 small nuclear ribonucleoprotein auxiliary factor small subunit.