Property Summary

NCBI Gene PubMed Count 79
PubMed Score 64.12
PubTator Score 68.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.300 3.0e-03
ependymoma 1.700 1.7e-03
oligodendroglioma 1.600 2.8e-03
tuberculosis and treatment for 6 months 1.300 6.3e-06
ovarian cancer -2.600 2.1e-18
pituitary cancer -1.800 1.1e-06

Gene RIF (31)

PMID Text
25964599 The mutational status of the SRSF2, U2AF1 and ZRSR2 did not affect the response rate or survival in MDS patients who had received first-line decitabine treatment.
25412851 In multivariate analysis, U2AF1 and TP53 mutations retained independent prognostic significance across 93 cases of acute myeloid leukemia
25326705 U2AF has the capacity to directly define ~88% of functional 3' splice sites in the human genome; numerous U2AF binding events also occur in intronic locations.
25311244 The S34F mutation alters U2AF1 function in the context of specific RNA sequences, leading to aberrant alternative splicing of target genes, some of which may be relevant for myelodysplastic syndromes pathogenesis.
25271374 A mutant U2AF1 (S34F) found in a variety of cancer types results in delayed splicing and disruption of kinetic competition during transcription.
25267526 mutations influence the similarity of splicing programs in leukemias, but do not give rise to widespread splicing failure.
25231745 Molecular monitoring of patients having undergone AHSCT for PMF should not be restricted to JAK2, MPL or CALR, but all mutations present in primary fibrotic neoplastic myeloproliferation should be included to interpret abnormal blood values after AHSCT
24498085 Data indicate somatic mutations in the splicing factor U2AF1 across 12 cancer types.
24097336 study describes incidence and phenotypic and prognostic relevance of U2AF1 mutations in primary myelofibrosis(PMF); U2AF1 mutations cluster with JAK2V617F, ASXL1 mutations and normal karyotype; U2AF1 mutations are strongly and inter-independently associated with anemia and thrombocytopenia
23861105 genetic association studies in a population in Taiwan: Data suggest that U2AF1 mutations are associated with poor prognosis/survival in patients with myelodysplastic syndrome and shorter time-to-leukemia transformation in young patients.
23775717 U2AF1 mutations play a significant role in myeloid leukemogenesis due to selective missplicing of tumor-associated genes
23335386 SRSF2 is the most frequently mutated spliceosome gene in chronic myelomonocytic leukemia, but neither it nor SF3B1 or U2AF35 mutations are prognostically relevant.
23280334 data suggest that SF3B1, U2AF1 and SRSF2 mutations occur not only in myeloid lineage tumors but also in lymphoid lineage tumors; data suggest that the splicing gene mutations play important roles in the pathogenesis of hematologic tumors, but rarely in solid tumors
23029227 U2AF1 mutation is a recurrent event at a low frequency in acute myeloid leukemia and myelodysplastic syndrome and influences overall survival.
22389253 In univariate analysis, mutated SRSF2 predicted shorter overall survival and more frequent acute myeloid leukemia progression compared with wild-type SRSF2, whereas mutated U2AF1, ZRSR2 had no impact on patient outcome.
22325350 hnRNP A1 forms a ternary complex with the U2AF heterodimer on AG-containing/uridine-rich RNAs, while it displaces U2AF from non-AG-containing/uridine-rich RNAs, an activity that requires the glycine-rich domain of hnRNP A1
22323480 U2AF1 and SRSF2 mutations are frequent in chronic myelomonocytic leukemia and advanced forms of MDS. U2AF1 and SRSF2 mutations are predictive for shorter survival.
22174317 HIV-1 Rev interacting protein, U2 small nuclear RNA auxiliary factor 1 (U2AF1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with U2AF1 is increased by RRE
22158538 Here we show that a missense mutation affecting the serine at codon 34 (Ser34) in U2AF1 was recurrently present in 13 out of 150 (8.7%) subjects with de novo MDS, and we found suggestive evidence of an increased risk of progression to sAML
20514852 Observational study of gene-disease association. (HuGE Navigator)
18285458 SF1 and U2AF form extraspliceosomal complexes before and after taking part in the assembly of catalytic spliceosomes.
18211889 U2AF35 and hPrp3 interactions with SPF30 can occur simultaneously, thereby potentially linking 3' splice site recognition with tri-small nuclear ribonucleoprotein addition
16940179 Results describe the roles of the two subunits of U2AF, U2AF65 and 35, in the selection between alternative 3' splice sites associated with polypyrimidine tracts of different strengths.
16855028 Taken together our results demonstrate that U2AF35a is essential for HeLa cell division and suggest a novel role for both U2AF35 protein isoforms as regulators of alternative splicing of a specific subset of genes.
16809543 DEK enforces 3' splice site discrimination by U2AF; DEK phosphorylated at serines 19 and 32 associates with U2AF35, facilitates the U2AF35-AG interaction and prevents binding of U2AF65 to pyrimidine tracts not followed by AG
16043505 identified and spatially localized sites of direct interaction between U2AF35 and U2AF65 in vivo in live cell nuclei.
15950937 Binding assays revealed that IpaH9.8 has a specific affinity to U2AF(35), a mammalian splicing factor, which interferes with U2AF(35)-dependent splicing as assayed for IgM pre-mRNA
15899895 U2AF35 appears to be completely dispensable for splicing in nuclear extracts prepared from adenovirus late-infected cells
15096518 U2AF1 gene expression may provide a mechanism by which the relative cellular concentration and availability of U2AF(35) protein isoforms are modulated, thus contributing to the finely tuned control of splicing events in different tissues.
12297299 U2AF35 RRM is unstructured in solution but its tertiary structure is induced upon binding to U2AF65.
11830556 A misspliced form of the cholecystokinin-B/gastrin receptor in pancreatic carcinoma: role of reduced sellular U2AF35 and a suboptimal 3'-splicing site leading to retention of the fourth intron.

AA Sequence

MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVS      1 - 70
DVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPI     71 - 140
HAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRELRRELYGRRRKKHRSRSRSRERRSRSRDRG    141 - 210
RGGGGGGGGGGGGRERDRRRSRDRERSGRF                                            211 - 240
//

Text Mined References (87)

PMID Year Title
25964599 2015 Mutations in the Spliceosomal Machinery Genes SRSF2, U2AF1, and ZRSR2 and Response to Decitabine in Myelodysplastic Syndrome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25412851 2015 Next-generation sequencing of acute myeloid leukemia identifies the significance of TP53, U2AF1, ASXL1, and TET2 mutations.
25343990 2015 Genome-wide association study of selenium concentrations.
25326705 2014 Mechanisms for U2AF to define 3' splice sites and regulate alternative splicing in the human genome.
25311244 2015 U2AF1 mutations alter sequence specificity of pre-mRNA binding and splicing.
25271374 2014 Kinetic competition during the transcription cycle results in stochastic RNA processing.
25267526 2015 U2AF1 mutations alter splice site recognition in hematological malignancies.
25231745 2015 SRSF2 and U2AF1 mutations in primary myelofibrosis are associated with JAK2 and MPL but not calreticulin mutation and may independently reoccur after allogeneic stem cell transplantation.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
24498085 2014 A pan-cancer analysis of transcriptome changes associated with somatic mutations in U2AF1 reveals commonly altered splicing events.
24241536 2014 High prevalence of MAP2K1 mutations in variant and IGHV4-34-expressing hairy-cell leukemias.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24097336 2014 U2AF1 mutations in primary myelofibrosis are strongly associated with anemia and thrombocytopenia despite clustering with JAK2V617F and normal karyotype.
23861105 2013 Clinical implications of U2AF1 mutation in patients with myelodysplastic syndrome and its stability during disease progression.
23775717 2013 Patterns of missplicing due to somatic U2AF1 mutations in myeloid neoplasms.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23335386 2013 Spliceosome mutations involving SRSF2, SF3B1, and U2AF35 in chronic myelomonocytic leukemia: prevalence, clinical correlates, and prognostic relevance.
23280334 2013 Mutational analysis of splicing machinery genes SF3B1, U2AF1 and SRSF2 in myelodysplasia and other common tumors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23029227 2012 U2AF1 mutations in Chinese patients with acute myeloid leukemia and myelodysplastic syndrome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22389253 2012 Frequency and prognostic impact of mutations in SRSF2, U2AF1, and ZRSR2 in patients with myelodysplastic syndromes.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22325350 2012 hnRNP A1 proofreads 3' splice site recognition by U2AF.
22323480 2012 Mutations in the spliceosome machinery, a novel and ubiquitous pathway in leukemogenesis.
22158538 2011 Recurrent mutations in the U2AF1 splicing factor in myelodysplastic syndromes.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21460037 2011 SKIP counteracts p53-mediated apoptosis via selective regulation of p21Cip1 mRNA splicing.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20696395 2010 Conserved beta-hairpin recognition by the GYF domains of Smy2 and GIGYF2 in mRNA surveillance and vesicular transport complexes.
20514852 2009 Variants of organic anion transporter polypeptide 2 gene are not risk factors associated with severe neonatal hyperbilirubinemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18285458 2008 Splicing factors SF1 and U2AF associate in extraspliceosomal complexes.
18211889 2008 Splicing factor SPF30 bridges an interaction between the prespliceosome protein U2AF35 and tri-small nuclear ribonucleoprotein protein hPrp3.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16940179 2006 In vivo requirement of the small subunit of U2AF for recognition of a weak 3' splice site.
16855028 2006 RNA interference knockdown of hU2AF35 impairs cell cycle progression and modulates alternative splicing of Cdc25 transcripts.
16809543 2006 Intron removal requires proofreading of U2AF/3' splice site recognition by DEK.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16043505 2005 FRET analyses of the U2AF complex localize the U2AF35/U2AF65 interaction in vivo and reveal a novel self-interaction of U2AF35.
15950937 2005 Shigella effector IpaH9.8 binds to a splicing factor U2AF(35) to modulate host immune responses.
15899895 2005 Substrate-dependent differences in U2AF requirement for splicing in adenovirus-infected cell extracts.
15652350 2005 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474994 2004 PAP-1, the mutated gene underlying the RP9 form of dominant retinitis pigmentosa, is a splicing factor.
15096518 2004 Diversity of vertebrate splicing factor U2AF35: identification of alternatively spliced U2AF1 mRNAS.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12297299 2002 Induced folding of the U2AF35 RRM upon binding to U2AF65.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11830556 2002 A misspliced form of the cholecystokinin-B/gastrin receptor in pancreatic carcinoma: role of reduced sellular U2AF35 and a suboptimal 3'-splicing site leading to retention of the fourth intron.
11724776 2002 U2AF participates in the binding of TAP (NXF1) to mRNA.
11604503 2001 Dual function for U2AF(35) in AG-dependent pre-mRNA splicing.
11551507 2001 A novel peptide recognition mode revealed by the X-ray structure of a core U2AF35/U2AF65 heterodimer.
11533230 2001 Domains in human splicing factors SF3a60 and SF3a66 required for binding to SF3a120, assembly of the 17S U2 snRNP, and prespliceosome formation.
11500380 2001 A novel U2 and U11/U12 snRNP protein that associates with the pre-mRNA branch site.
11448987 2001 ZNF265--a novel spliceosomal protein able to induce alternative splicing.
11118443 2001 Nucleocytoplasmic shuttling of heterodimeric splicing factor U2AF.
11060040 2000 Human pre-mRNA cleavage factor II(m) contains homologs of yeast proteins and bridges two other cleavage factors.
10830953 2000 The DNA sequence of human chromosome 21.
9799243 1998 Phosphorylation-dephosphorylation differentially affects activities of splicing factor ASF/SF2.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
9645944 1998 Functional association of nuclear protein 4.1 with pre-mRNA splicing factors.
9472028 1998 SRPK2: a differentially expressed SR protein-specific kinase involved in mediating the interaction and localization of pre-mRNA splicing factors in mammalian cells.
9237760 1997 A protein related to splicing factor U2AF35 that interacts with U2AF65 and SR proteins in splicing of pre-mRNA.
9016565 1997 Association of U2 snRNP with the spliceosomal complex E.
8660980 1996 The gene for human U2 snRNP auxiliary factor small 35-kDa subunit (U2AF1) maps to the progressive myoclonus epilepsy (EPM1) critical region on chromosome 21q22.3.
8647433 1996 The splicing factor U2AF35 mediates critical protein-protein interactions in constitutive and enhancer-dependent splicing.
8261509 1993 Specific interactions between proteins implicated in splice site selection and regulated alternative splicing.
7956352 1995 Comparative mapping of the imprinted U2afbpL gene on mouse chromosome 11 and human chromosome 5.
2531895 1989 Identification, purification, and biochemical characterization of U2 small nuclear ribonucleoprotein auxiliary factor.
1824937 1991 Biochemical characterization of U2 snRNP auxiliary factor: an essential pre-mRNA splicing factor with a novel intranuclear distribution.
1388271 1992 Cloning and intracellular localization of the U2 small nuclear ribonucleoprotein auxiliary factor small subunit.