Property Summary

NCBI Gene PubMed Count 7
PubMed Score 11.38
PubTator Score 5.33

Knowledge Summary


No data available


Gene RIF (1)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

PHWALFGASERGFDPKDTRHQRKNKSKAISGC                                          701 - 732

Text Mined References (7)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17150819 2006 Ribonucleome analysis identified enzyme genes responsible for wybutosine synthesis.
16162496 2005 Discovery of a gene family critical to wyosine base formation in a subset of phenylalanine-specific transfer RNAs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.