Property Summary

NCBI Gene PubMed Count 80
PubMed Score 876.68
PubTator Score 232.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 1.0
Disease Target Count Z-score Confidence
Oculocutaneous albinism 29 6.449 3.2
Disease Target Count
Albinism, Oculocutaneous, Type 3 1

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.900 8.0e-03
Astrocytoma, Pilocytic -1.100 9.1e-03
cutaneous lupus erythematosus -3.700 1.7e-02
ependymoma -2.000 1.5e-02
glioblastoma -1.400 7.2e-04
intraductal papillary-mucinous adenoma (... -1.100 7.3e-03
lung adenocarcinoma -1.100 2.3e-05
malignant mesothelioma -1.800 4.8e-06
non-small cell lung cancer -1.646 1.7e-17
oligodendroglioma -2.000 6.9e-03
primitive neuroectodermal tumor -1.700 3.6e-04
psoriasis 1.600 9.0e-03

 CSPA Cell Line (2)

Gene RIF (54)

AA Sequence

MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTA      1 - 70
DSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEE     71 - 140
KNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGE    141 - 210
VDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPN    211 - 280
SVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSN    281 - 350
STNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA    351 - 420
DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIAIAVVGALLLV    421 - 490
ALIFGTASYLIRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV                           491 - 537
//

Text Mined References (82)

PMID Year Title