Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8TAI1 A8K1S1
Symbols C18orf56

Gene

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGVCKARRTMRPLPRRIEVRTKR      1 - 70
GPQRPAAPERSPQPRLPPSRHPSRRGPRRHLSGCSAPACRIPTGCRCPCGRPS                      71 - 123
//

Text Mined References (10)

PMID Year Title