Property Summary

Ligand Count 293
NCBI Gene PubMed Count 511
PubMed Score 732.02
PubTator Score 609.54

Knowledge Summary


No data available


  Disease (5)


  Differential Expression (34)

Disease log2 FC p
adrenocortical carcinoma 1.973 5.0e-04
adult high grade glioma 2.000 2.1e-04
Astrocytoma, Pilocytic 1.200 5.0e-05
Atopic dermatitis 1.400 2.6e-05
atypical teratoid / rhabdoid tumor 3.800 6.1e-11
Breast cancer 1.100 7.4e-07
breast carcinoma 1.900 7.9e-06
cystic fibrosis and chronic rhinosinusit... 1.229 6.4e-03
Down syndrome 1.300 3.3e-03
ductal carcinoma in situ 1.500 1.6e-03
Endometriosis 2.110 2.0e-02
ependymoma 2.100 6.5e-08
fibroadenoma 1.200 2.0e-02
glioblastoma 2.800 6.1e-11
group 3 medulloblastoma 3.800 3.8e-07
interstitial cystitis 1.300 3.0e-02
intraductal papillary-mucinous carcinoma... 2.100 7.2e-03
intraductal papillary-mucinous neoplasm ... 2.200 2.3e-02
invasive ductal carcinoma 1.800 1.1e-03
lung adenocarcinoma 1.200 4.1e-09
lung cancer 2.500 2.2e-04
medulloblastoma, large-cell 4.300 9.5e-08
nasopharyngeal carcinoma 1.200 7.0e-05
non-small cell lung cancer 2.370 1.1e-26
ovarian cancer 1.200 3.1e-02
pancreatic cancer 1.100 1.4e-04
Pick disease -1.400 9.9e-03
pituitary cancer 1.400 2.2e-03
primary Sjogren syndrome 1.700 4.6e-04
primitive neuroectodermal tumor 3.900 1.2e-07
progressive supranuclear palsy -1.600 3.8e-02
psoriasis 1.200 2.6e-32
tuberculosis 1.400 1.4e-04
Waldenstrons macroglobulinemia 1.992 1.7e-02

PDB (50)

Gene RIF (554)

AA Sequence

ILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV                                         281 - 313

Text Mined References (517)

PMID Year Title