Property Summary

NCBI Gene PubMed Count 130
PubMed Score 237.97
PubTator Score 197.81

Knowledge Summary

Patent (37,849)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.800 2.1e-04
ependymoma 1.300 6.7e-03
oligodendroglioma 1.100 8.9e-03
osteosarcoma -1.584 1.1e-04
glioblastoma 1.300 2.6e-02
ovarian cancer 1.300 1.2e-05

 OMIM Phenotype (1)

Protein-protein Interaction (4)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (82)

PMID Text
26359499 The majority of disease-associated mutations in JAKs map to a pseudokinase domain (JH2), demonstrating its central regulatory function.
26294277 Genetic associations and gene-gene interactions of IRF5 and TYK2 were significantly detected in Han Chinese with systemic lupus erythematosus
26288847 The TYK2 promoter variant is associated with an overall risk for diabetes.
26239055 present findings suggest that TYK2 regulates apoptotic and proinflammatory pathways in pancreatic beta-cells via modulation of IFNalpha signaling, subsequent increase in MHC class I protein, and modulation of chemokines such as CXCL10.
25849893 the role of TYK2 in the pathogenesis of rheumatoid arthritis
25762719 Tyrosine Kinase 2-mediated Signal Transduction in T Lymphocytes Is Blocked by Pharmacological Stabilization of Its Pseudokinase Domain.
25744728 demonstration of the single marker association of tyrosine kinase-2 polymorphisms with ulcerative colitis and Crohn's disease in Turkish population.
25349176 Data indicate a chimeric fusion involving nucleophosmin NPM1 (5q35) and TYK2 kinase (19p13) that encodes an NPM1-TYK2 protein in cutaneous CD30 antigen-positve lymphoproliferative disorders.
25156366 In cellular assays, SAR-20347 dose dependently (1 nM-10 muM) inhibited JAK1- and/or TYK2-dependent signaling from the IL-12/IL-23, IL-22, and IFN-alpha receptors.
24843152 Here, we report the 2.8-A structure of the two-domain pseudokinase-kinase module from the JAK family member TYK2 in its autoinhibited form.
24833526 the E3 ubiquitin ligase seven-in-absentia-2 (SIAH2) accelerates the proteasomal degradation of TYK which consequently suppresses the activation of STAT3 in non-small-cell lung cancer
24812289 TYK2 as a novel associated locus for idiopathic inflammatory myopathies.
24704786 The crystal structure of a receptor-binding fragment of human TYK2, encompassing the FERM and SH2 domains, in complex with peptide motif from the interferon-alpha receptor chain 1 (IFNAR1) is presented.
24654603 Immune cell dysfunction may contribute to enhancement and maintenance of immune inflammatory and autoimmune responses by production of pathogenic cytokines and immune complexes. The role of Tyk2 in innate and adaptive immune cells is discussed. Review.
23894201 Our results indicate that the biological processes that require TYK2 catalytic function in humans are restricted to the IL-12 and IL-23 pathways.
23471820 A novel oncogenic pathway is identified that involves aberrant activation of the TYK2 and its downstream substrate, STAT1, which ultimately promotes T-cell acute lymphoblastic leukemia cell survival through the upregulation of BCL2 expression
23408403 None of the single nucleotide polymorphisms of either TYK2 or STAT3 was statistically associated with the susceptibility to CD in our local population (P > 0.05).
23359498 Two rare autoimmune disease-associated Tyk2 variants are catalytically impaired but signaling competent.
23000200 TYK2 rs34536443 polymorphism is associated with a decreased susceptibility to endometriosis-related infertility.
22961000 The most associated variant in primary biliary cirrhosis was in chromosome 19, a low-frequency nonsynonymous single nucleotide polymorphism in TYK2.
22744673 This study demonistrated that Rs55762744 is a rare variant of modest effect on multiple sclerosis risk affecting a subset of patients.
22592861 The rs6445975 polymorphism of phox homology domain containing serine/threonine kinase and the rs2304256 polymorphism of tyrosine kinase 2 are associated with the development of systemic lupus erythematosus in Europeans
22506826 In our pilot study, we discovered significant changes in methylation patterns of genes IL-7, IL-13, IL-17C and TYK2 between henodialysis patients and healthy subjects
22486643 Studied the doubly tagged full-length construct, H6-FL-TYK-2-FLAG. In the presence of ATP and a peptide substrate, H6-FL-TYK-2-FLAG showed a marked lag in phosphopeptide product formation. TYK-2 KD showed no such lag.
22116632 data highlight the role of TYK2 downregulation in breast cancer cell de-differentitation and initiation of regional metastasis
22046141 Association analysis identified five SLE susceptibility genes reaching genome-wide levels of significance : NCF2 ,IKZF1 ,IRF8 ,IFIH1 , and TYK2
21949722 infection of airway epithelial cells with hMPV decreased cellular level of Janus tyrosine kinase (Jak1) and tyrosine kinase 2 (Tyk2)
21757742 The consequent effect of SOCS1 inhibition of Tyk2 not only results in a reduced IFN response because of inhibition of Tyk2 kinase-mediated STAT signaling but also negatively impacts IFNAR1 surface expression, which is stabilized by Tyk2.
21354972 The rs34536443 variant effect on multiple sclerosis susceptibility might be mediated by deviating T lymphocyte differentiation toward a Th2 phenotype.
21196586 Data suggest that TYK2 polymorphisms were not associated with systemic lupus erythematosus in Hong Kong Chinese, but that rs2304256 and rs12720270 may be associated with photosensitivity and discoid rash.
21178271 Tyk2 deficiency and clinical manifestations of hyper IgE syndromes (Review)
21140222 This meta-analysis demonstrates that autoimmune and inflammatory diseases is associated with TYK2 gene rs34536443 and rs2304256 polymorphisms, but not rs280523, rs280519, rs12720270 and rs12720356.
20953190 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20727854 Siva-1 forms a functional complex with Tyk2 and participates in the transduction of signals that inhibit B lymphocyte growth.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20478313 Here, the authors report the crystal structures of TYK2, a first in class structure, and JAK3 in complex with PAN-JAK inhibitors CP-690550 and CMP-6, both of which bind in the ATP-binding cavities of both JAK isozymes.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20197570 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20065083 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19966805 Studies indicate that the highest T1D association was at marker rs2304256 (odds ratio (OR) = 0.86; 95%CI = 0.82-0.90) in the TYK2 gene 19p13.2See TYK2 gene at chromosome 19p13.2.
19888296 Single-nucleotide polymorphism in TYK2 gene is confirmed to be associated with multiple sclerosis.
19888296 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19865102 Observational study of gene-disease association. (HuGE Navigator)
19758313 rs2304256 associated with increased risk of discoid lupus erythematosus
19730683 Observational study of gene-disease association. (HuGE Navigator)
19717292 Studies have demonstrated that mutations in STAT3 and TYK2 genes result in Hyper-IgE syndrome (HIES.
19653082 TYK2 and STAT3 are genetic determinants of Crohn's disease in the Japanese population.
19653082 Observational study of gene-disease association. (HuGE Navigator)
19567624 The IFN pathway genes IRF5 and TYK2 may act epistatically in increasing risk for systemic lupus erythematosus
19525955 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19464057 Observational study of gene-disease association. (HuGE Navigator)
19440814 TYK2 is not a genetic risk factor for systemic lupus erythematosus in a Japanese population suggesting that there is an ethnic difference in the susceptibility genes for this disease.
19434718 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19293837 TYK2 may be a multiple sclerosis susceptibility factor
19293837 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19254804 when type I IFN is added to primary human fibroblasts following MV infection, the tyrosine phosphorylation of the Janus kinase Tyk2 is specifically blocked, thereby preventing the subsequent activation of downstream STAT1 and STAT2
19249008 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18474601 Tyk2 contributes to both the regulation of total IFNAR1 levels as well as the regulation of the cell surface density of this receptor chain.
18456658 The Stat3-activating Tyk2 V678F mutant does not up-regulate signaling through the type I interferon receptor but confers ligand hypersensitivity to a homodimeric receptor
18270328 Observational study of gene-disease association. (HuGE Navigator)
17937105 protein tyrosine kinase TYK2 genes were found significantly upregulated in the cases with progressive sarcoidosis.
17920038 These results suggest that Tyk2 signaling in prostate cancer cells facilitate invasion of these cells, and interference with this signaling may be a potential therapeutic pathway.
17877826 This in vitro study provides evidence that altered expression of the Jak-Stat signaling proteins can cause IFN resistance
17703412 Observational study of gene-disease association. (HuGE Navigator)
17599733 Observational study of gene-disease association. (HuGE Navigator)
17548050 suggest a novel function for Tyk2 as an important modulator of the urokinase-directed vascular smooth muscle cell functional behaviour at the place of injury
17384181 Observational study of gene-disease association. (HuGE Navigator)
17384181 study showed association to systemic lupus erythematosus from individual SNPs and haplotypes in TYK2
17011030 Tyk2 mutation is not associated with essential thrombocythaemia
16551269 catalytic activation of Tyk2 is not essential for IFNAR1 internalization, but is required for ligand-induced IFNAR1 serine phosphorylation, ubiquitination and efficient lysosomal proteolysis
16239216 mutations in the JAK1 and Tyk2 genes may be identified as initial molecular defects in human cancers and autoimmune diseases
15944400 Janus kinase Tyk2 and the transcription factor Stat3 serve as downstream components in the signaling cascade resulting in upregulation of C5aR expression
15883164 In the IFN signaling pathway leading to STAT activation, both JAK1 and TYK2 are essential, whereas NF-kappaB activation requires only TYK2.
15657875 Observational study of gene-disease association. (HuGE Navigator)
14500680 Catalytically active Tyk2 is necessary for Janus kinase 2 phosphorylation and association with the platelet-activating factor receptor.
12719789 evidence that the small GTPases RhoA and Rac1, but not Cdc42, are directly associated with Tyk2 and PI3-K in an uPA/uPAR-dependent fashion and are necessary to mediate the uPA/uPAR-directed migration via the Tyk2/PI3-K signalling complex in human VSMC
12554654 Data show that Tyk2 tyrosine kinase is essential for stable cell surface expression of IFNAR1.

AA Sequence

MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHIAHKVGITPPC      1 - 70
FNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREPAVYRCGPPGTEASSDQTAQG     71 - 140
MQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFKNESLGMAFLHLCHLALRHGIPLEEVAKKTS    141 - 210
FKDCIPRSFRRHIRQHSALTRLRLRNVFRRFLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHL    211 - 280
RLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQAS    281 - 350
LFGKKAKAHKAVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV    351 - 420
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHPYRLILTVAQR    421 - 490
SQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRAGDDCFSLRRCCLPQPGETSN    491 - 560
LIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTRTNVYEGRLRVEGSGDPEEGKMDDEDPLVPG    561 - 630
RDRGQELRVVLKVLDPSHHDIALAFYETASLMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLR    631 - 700
RERGHVPMAWKMVVAQQLASALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSRE    701 - 770
ERVERIPWLAPECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ    771 - 840
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKIRDLGEGHFGK    841 - 910
VSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEY    911 - 980
VPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPE    981 - 1050
GHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMT   1051 - 1120
VLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC      1121 - 1187
//

Text Mined References (135)

PMID Year Title
26359499 2015 Structural and Functional Characterization of the JH2 Pseudokinase Domain of JAK Family Tyrosine Kinase 2 (TYK2).
26294277 2015 Genetic association and interaction between the IRF5 and TYK2 genes and systemic lupus erythematosus in the Han Chinese population.
26288847 2015 TYK2 Promoter Variant and Diabetes Mellitus in the Japanese.
26239055 2015 TYK2, a Candidate Gene for Type 1 Diabetes, Modulates Apoptosis and the Innate Immune Response in Human Pancreatic ?-Cells.
25849893 2015 TYK2 protein-coding variants protect against rheumatoid arthritis and autoimmunity, with no evidence of major pleiotropic effects on non-autoimmune complex traits.
25762719 2015 Tyrosine Kinase 2-mediated Signal Transduction in T Lymphocytes Is Blocked by Pharmacological Stabilization of Its Pseudokinase Domain.
25744728 2015 Tyrosine kinase-2 gene polymorphisms are associated with ulcerative colitis and Crohn's disease in Turkish Population.
25416956 2014 A proteome-scale map of the human interactome network.
25349176 2014 A novel recurrent NPM1-TYK2 gene fusion in cutaneous CD30-positive lymphoproliferative disorders.
25156366 2014 Inhibition of TYK2 and JAK1 ameliorates imiquimod-induced psoriasis-like dermatitis by inhibiting IL-22 and the IL-23/IL-17 axis.
24843152 2014 Structure of the pseudokinase-kinase domains from protein kinase TYK2 reveals a mechanism for Janus kinase (JAK) autoinhibition.
24833526 2014 SIAH2 antagonizes TYK2-STAT3 signaling in lung carcinoma cells.
24812289 2014 Genotyping of immune-related genetic variants identifies TYK2 as a novel associated locus for idiopathic inflammatory myopathies.
24704786 2014 Structural basis of recognition of interferon-? receptor by tyrosine kinase 2.
24654603 2014 Therapeutic potential of tyrosine kinase 2 in autoimmunity.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23894201 2013 A restricted role for TYK2 catalytic activity in human cytokine responses revealed by novel TYK2-selective inhibitors.
23471820 2013 TYK2-STAT1-BCL2 pathway dependence in T-cell acute lymphoblastic leukemia.
23408403 2013 Lack of association between TYK2 and STAT3 genes and Crohn's disease in the Malaysian population.
23359498 2013 Two rare disease-associated Tyk2 variants are catalytically impaired but signaling competent.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23000200 2013 TYK2 rs34536443 polymorphism is associated with a decreased susceptibility to endometriosis-related infertility.
22961000 2012 Dense fine-mapping study identifies new susceptibility loci for primary biliary cirrhosis.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22744673 2012 Exome sequencing identifies a novel multiple sclerosis susceptibility variant in the TYK2 gene.
22592861 2012 Associations between PXK and TYK2 polymorphisms and systemic lupus erythematosus: a meta-analysis.
22506826 2012 Alterations in methylation status of immune response genes promoters in cell-free DNA during a hemodialysis procedure.
22486643 2012 Differential kinetics and inhibition of purified recombinant tyrosine kinase 2 (TYK-2) and its catalytic domain JH-1.
22116632 2012 Non-receptor tyrosine kinase 2 reaches its lowest expression levels in human breast cancer during regional nodal metastasis.
22046141 2011 Association of NCF2, IKZF1, IRF8, IFIH1, and TYK2 with systemic lupus erythematosus.
21949722 2011 Human metapneumovirus inhibits IFN-? signaling by downregulating Jak1 and Tyk2 cellular levels.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
21757742 2011 Suppressor of cytokine signaling (SOCS) 1 inhibits type I interferon (IFN) signaling via the interferon alpha receptor (IFNAR1)-associated tyrosine kinase Tyk2.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21354972 2011 Tyrosine kinase 2 variant influences T lymphocyte polarization and multiple sclerosis susceptibility.
21196586 2011 Lack of association of TYK2 gene polymorphisms in Chinese patients with systemic lupus erythematosus.
21178271 2010 Clinical manifestations of hyper IgE syndromes.
21140222 2011 Meta-analysis of TYK2 gene polymorphisms association with susceptibility to autoimmune and inflammatory diseases.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
20727854 2010 Tyrosine kinase 2 interacts with the proapoptotic protein Siva-1 and augments its apoptotic functions.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20478313 2010 Structural and thermodynamic characterization of the TYK2 and JAK3 kinase domains in complex with CP-690550 and CMP-6.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20197570 2010 Lack of interaction between systemic lupus erythematosus-associated polymorphisms in TYK2 and IRF5.
20065083 2010 A polymorphism associated with STAT3 expression and response of chronic myeloid leukemia to interferon ?.
19966805 2010 The imprinted DLK1-MEG3 gene region on chromosome 14q32.2 alters susceptibility to type 1 diabetes.
19888296 2010 A rare variant of the TYK2 gene is confirmed to be associated with multiple sclerosis.
19865102 2010 Multiple sclerosis susceptibility alleles in African Americans.
19758313 2010 Tyrosine kinase 2 and interferon regulatory factor 5 polymorphisms are associated with discoid and subacute cutaneous lupus erythematosus.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19717292 2009 Hyper-IgE syndrome.
19653082 2009 Strong evidence of a combination polymorphism of the tyrosine kinase 2 gene and the signal transducer and activator of transcription 3 gene as a DNA-based biomarker for susceptibility to Crohn's disease in the Japanese population.
19567624 2009 Evidence for genetic association and interaction between the TYK2 and IRF5 genes in systemic lupus erythematosus.
19525955 2009 Genome-wide association study identifies new multiple sclerosis susceptibility loci on chromosomes 12 and 20.
19464057 2009 A high-throughput candidate gene mutation screen in lymphoproliferative and myeloproliferative neoplasias.
19440814 2009 Lack of association between tyrosine kinase 2 (TYK2) gene polymorphisms and susceptibility to SLE in a Japanese population.
19434718 2009 Variants in interferon-alpha pathway genes and response to pegylated interferon-Alpha2a plus ribavirin for treatment of chronic hepatitis C virus infection in the hepatitis C antiviral long-term treatment against cirrhosis trial.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19293837 2009 Replication analysis identifies TYK2 as a multiple sclerosis susceptibility factor.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19254804 2009 Myxoma virus selectively disrupts type I interferon signaling in primary human fibroblasts by blocking the activation of the Janus kinase Tyk2.
19249008 2009 Diverse genome-wide association studies associate the IL12/IL23 pathway with Crohn Disease.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18474601 2008 Basal ubiquitin-independent internalization of interferon alpha receptor is prevented by Tyk2-mediated masking of a linear endocytic motif.
18456658 2008 The Stat3-activating Tyk2 V678F mutant does not up-regulate signaling through the type I interferon receptor but confers ligand hypersensitivity to a homodimeric receptor.
18270328 2008 Somatic mutations and germline sequence variants in the expressed tyrosine kinase genes of patients with de novo acute myeloid leukemia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17937105 2006 Progressive pulmonary sarcoidosis is associated with over-expression of TYK2 and p21Waf1/Cip1.
17920038 2008 Tyk2 expression and its signaling enhances the invasiveness of prostate cancer cells.
17877826 2007 Reduced expression of Jak-1 and Tyk-2 proteins leads to interferon resistance in hepatitis C virus replicon.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17599733 2007 Association of a haplotype in the promoter region of the interferon regulatory factor 5 gene with rheumatoid arthritis.
17548050 2007 Tyk2 mediates effects of urokinase on human vascular smooth muscle cell growth.
17384181 2007 Association of polymorphisms across the tyrosine kinase gene, TYK2 in UK SLE families.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17088085 2006 Human tyrosine kinase 2 deficiency reveals its requisite roles in multiple cytokine signals involved in innate and acquired immunity.
17011030 2007 Tyk2 mutation homologous to V617F Jak2 is not found in essential thrombocythaemia, although it induces constitutive signaling and growth factor independence.
16551269 2006 TYK2 activity promotes ligand-induced IFNAR1 proteolysis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16239216 2005 JAK1 and Tyk2 activation by the homologous polycythemia vera JAK2 V617F mutation: cross-talk with IGF1 receptor.
15944400 2005 Urokinase-induced activation of the gp130/Tyk2/Stat3 pathway mediates a pro-inflammatory effect in human mesangial cells via expression of the anaphylatoxin C5a receptor.
15883164 2005 Interferon alpha activates NF-kappaB in JAK1-deficient cells through a TYK2-dependent pathway.
15657875 2005 Polymorphisms in the tyrosine kinase 2 and interferon regulatory factor 5 genes are associated with systemic lupus erythematosus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15277531 2004 Jamip1 (marlin-1) defines a family of proteins interacting with janus kinases and microtubules.
14500680 2003 Janus kinase 2 activation by the platelet-activating factor receptor (PAFR): roles of Tyk2 and PAFR C terminus.
12960323 2003 The WD motif-containing protein RACK-1 functions as a scaffold protein within the type I IFN receptor-signaling complex.
12719789 2003 Urokinase-induced migration of human vascular smooth muscle cells requires coupling of the small GTPases RhoA and Rac1 to the Tyk2/PI3-K signalling pathway.
12554654 2003 The tyrosine kinase Tyk2 controls IFNAR1 cell surface expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11694501 2001 TYK2 and JAK2 are substrates of protein-tyrosine phosphatase 1B.
11430697 2001 Immunolocalisation of the janus kinases (JAK)--signal transducers and activators of transcription (STAT) pathway in human epidermis.
11399767 2001 The receptor interaction region of Tyk2 contains a motif required for its nuclear localization.
10995743 2000 Urokinase stimulates human vascular smooth muscle cell migration via a phosphatidylinositol 3-kinase-Tyk2 interaction.
10933219 2000 Expression of the janus kinases-signal transducers and activators of transcription pathway in Hassall's corpuscles of the human thymus.
10899310 2000 STAM2, a new member of the STAM family, binding to the Janus kinases.
10673353 2000 Interferon-alpha signaling promotes nucleus-to-cytoplasmic redistribution of p95Vav, and formation of a multisubunit complex involving Vav, Ku80, and Tyk2.
10542297 1999 Catalytically active TYK2 is essential for interferon-beta-mediated phosphorylation of STAT3 and interferon-alpha receptor-1 (IFNAR-1) but not for activation of phosphoinositol 3-kinase.
10531356 1999 The human homologue of the yeast proteins Skb1 and Hsl7p interacts with Jak kinases and contains protein methyltransferase activity.
10523853 1999 The human papilloma virus (HPV)-18 E6 oncoprotein physically associates with Tyk2 and impairs Jak-STAT activation by interferon-alpha.
10502458 1999 The growth hormone receptor associates with Jak1, Jak2 and Tyk2 in human liver.
10409622 1999 Characterization of the cytoplasmic domain of interleukin-13 receptor-alpha.
9822675 1998 Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.
9733772 1998 Specific contribution of Tyk2 JH regions to the binding and the expression of the interferon alpha/beta receptor component IFNAR1.
9633884 1998 Interferon alpha activates the tyrosine kinase Lyn in haemopoietic cells.
9519782 1998 Reduced Tyk2/SHP-1 interaction and lack of SHP-1 mutation in a kindred of familial hemophagocytic lymphohistiocytosis.
9388212 1997 Transmembrane domain of gp130 contributes to intracellular signal transduction in hepatic cells.
9374471 1997 The type I interferon receptor mediates tyrosine phosphorylation of the CrkL adaptor protein.
9342324 1997 The amino-terminal region of Tyk2 sustains the level of interferon alpha receptor 1, a component of the interferon alpha/beta receptor.
9305869 1997 Janus kinase-dependent activation of insulin receptor substrate 1 in response to interleukin-4, oncostatin M, and the interferons.
9196040 1997 Interaction of p59fyn with interferon-activated Jak kinases.
9108397 1997 Thrombopoietin and thrombin induce tyrosine phosphorylation of Vav in human blood platelets.
8780698 1996 Interaction of the c-cbl proto-oncogene product with the Tyk-2 protein tyrosine kinase.
8702790 1996 Interferon-alpha-dependent activation of Tyk2 requires phosphorylation of positive regulatory tyrosines by another kinase.
8550573 1996 The type I interferon receptor mediates tyrosine phosphorylation of insulin receptor substrate 2.
8432525 1993 Fluorescence in situ hybridization mapping of human chromosome 19: cytogenetic band location of 540 cosmids and 70 genes or DNA markers.
8232552 1993 The protein tyrosine kinase JAK1 complements defects in interferon-alpha/beta and -gamma signal transduction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7629131 1995 Association of the interferon-dependent tyrosine kinase Tyk-2 with the hematopoietic cell phosphatase.
7589562 1995 Homodimerization and intermolecular tyrosine phosphorylation of the Tyk-2 tyrosine kinase.
7579387 1995 Colony-stimulating factor 1-induced STAT1 and STAT3 activation is accompanied by phosphorylation of Tyk2 in macrophages and Tyk2 and JAK1 in fibroblasts.
7526154 1994 Direct binding to and tyrosine phosphorylation of the alpha subunit of the type I interferon receptor by p135tyk2 tyrosine kinase.
7510216 1994 Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.
2247464 1990 Putative tyrosine kinases expressed in K-562 human leukemia cells.
2216457 1990 tyk2, prototype of a novel class of non-receptor tyrosine kinase genes.
2156206 1990 Identification and chromosomal mapping of new human tyrosine kinase genes.
1386289 1992 A protein tyrosine kinase in the interferon alpha/beta signaling pathway.