Property Summary

NCBI Gene PubMed Count 51
PubMed Score 446.42
PubTator Score 84.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 2.100 4.7e-08
osteosarcoma -1.023 6.6e-05

Protein-protein Interaction (2)

Gene RIF (37)

PMID Text
26752265 A meta-analysis of the top SNPs identified three new associated loci in primary open angle glaucoma--TXNRD2, ATXN2, and FOXC1
26573231 Data suggest that TXNRD2 may represent a druggable target that could be deployed to reduce the development of fatal pulmonary metastases in patients with osteosarcoma (OS).
26469385 HIV-1 MA upregulates TXNRD2 (TR3) gene expression in HepG2 cells
25703281 The TXNRD2 rs 1548357 polymorphism might be a genetic risk factor for Myocardial infarction in subjects with T2 Diabetes mellitus of Slovenian origin.
24624337 Data suggest TXNRD1 and TXRNRD2 function at the top of a redox pyramid that governs the oxidation state of peroxiredoxins and other protein factors, thereby dictating a hierarchy of phenotypic responses to oxidative insults.
24601690 Absence of TXNRD2 in humans leads to glucocorticoid deficiency.
24058403 Single Nucleotide Polymorphisms in the genes GPX1 (rs1050450, rs1800668 and rs3811699), TrxR2 (rs5748469), and DIO2 (rs225014) may not be significantly associated with Kashin-Beck disease in a Tibetan population.
23597419 Development of subcutaneous fibrosis can be associated with genetic variation in the mitochondrial enzyme TXNRD2, critically involved in removal of ROS, and maintenance of the intracellular redox balance.
23063346 Data suggest that dietary factor (selenium supplementation) up-regulates endogenous antioxidant systems and protects trophoblasts from oxidative stress; selenium upregulates GPX1 (glutathione peroxidase 1) and thioredoxin reductases (TXNRD1; TXNRD2).
22683372 A role of GPx2, TrxR2 and TrxR3 in proliferation, apoptosis and, therefore, also during cancer development.
21247928 Mutation of this gene is involved in regulation of cellular redoc state in Dilated Cardiomyopathy.
21172426 study reveals significant differences between TrxR1 and TrxR2 in substrate specificity and metal compound inhibition in vitro and in cells
20965815 No obvious correlation can be found between rs5748469 polymorphisms in TrxR2 gene and the susceptibility to Kashin-Beck disease.
20965815 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20378690 Observational study of gene-disease association. (HuGE Navigator)
20178852 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19896490 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19617637 Over-expression of TXNRD2, COMT and ARVCF affects incentive learning and working memory in transgenic mice.
19595745 Observations underpin a likely critical antioxidant role for TrxR2 and TrxR1 in the endothelium.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19035188 The GPX1 198 Pro/Pro and TXNRD2 370Arg/Arg genotypes might be associated with the genetic susceptibility of gastric cancer.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
17634480 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
17395017 Nuclear extracts from rat lungs administered this reduced recombinant protein suggest a role for NF-kappaB in proinflammatory responses.
16868544 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16774913 the function of TR3 is not limited to its role in Trx2 reduction
16424062 Observational study of gene-disease association. (HuGE Navigator)
12705894 Involvements of mitochondrial thioredoxin reductase in cell proliferation.
12530083 Mitochondrial thioredoxin reductase and peroxiredoxin III are overexpressed in hepatocellular carcinomas.
12374691 mammary tumors expressing the wild-type TR were readily suppressed by the IFN/RA combination. In contrast, the tumors bearing a mutant TR were resistant to regression.

AA Sequence

MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQLGRKVAVVDY      1 - 70
VEPSPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPNYGWEVAQPVPHDWRKMAEAVQNHVKSLN     71 - 140
WGHRVQLQDRKVKYFNIKASFVDEHTVCGVAKGGKEILLSADHIIIATGGRPRYPTHIEGALEYGITSDD    141 - 210
IFWLKESPGKTLVVGASYVALECAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCA    211 - 280
PSRVRRLPDGQLQVTWEDSTTGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATS    281 - 350
VPHIYAIGDVVEGRPELTPIAIMAGRLLVQRLFGGSSDLMDYDNVPTTVFTPLEYGCVGLSEEEAVARHG    351 - 420
QEHVEVYHAHYKPLEFTVAGRDASQCYVKMVCLREPPQLVLGLHFLGPNAGEVTQGFALGIKCGASYAQV    421 - 490
MRTVGIHPTCSEEVVKLRISKRSGLDPTVTGCUG                                        491 - 524
//

Text Mined References (54)

PMID Year Title
26752265 2016 Genome-wide association analysis identifies TXNRD2, ATXN2 and FOXC1 as susceptibility loci for primary open-angle glaucoma.
26573231 2016 Auranofin is a potent suppressor of osteosarcoma metastasis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25703281 2015 Association of thioredoxin reductase 2 (TXNRD2) gene polymorphisms with myocardial infarction in Slovene patients with type 2 diabetes mellitus.
24847357 2014 Genome wide association study of SNP-, gene-, and pathway-based approaches to identify genes influencing susceptibility to Staphylococcus aureus infections.
24624337 2014 Resolution of oxidative stress by thioredoxin reductase: Cysteine versus selenocysteine.
24601690 2014 Thioredoxin Reductase 2 (TXNRD2) mutation associated with familial glucocorticoid deficiency (FGD).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24058403 2013 Association study of polymorphisms in selenoprotein genes and Kashin-Beck disease and serum selenium/iodine concentration in a Tibetan population.
23597419 2013 SNP in TXNRD2 associated with radiation-induced fibrosis: a study of genetic variation in reactive oxygen species metabolism and signaling.
23063346 2012 Selenium supplementation protects trophoblast cells from oxidative stress.
22922875 2012 Genome-wide association analyses identify three new susceptibility loci for primary angle closure glaucoma.
22683372 2012 The selenoproteins GPx2, TrxR2 and TrxR3 are regulated by Wnt signalling in the intestinal epithelium.
21269460 2011 Initial characterization of the human central proteome.
21247928 2011 Mutations in the mitochondrial thioredoxin reductase gene TXNRD2 cause dilated cardiomyopathy.
21172426 2011 Substrate and inhibitor specificities differ between human cytosolic and mitochondrial thioredoxin reductases: Implications for development of specific inhibitors.
20965815 2010 [TrxR2 gene polymorphisms may not be associated with the susceptibility to Kashin-Beck disease].
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20413580 2010 Human ADA3 regulates RARalpha transcriptional activity through direct contact between LxxLL motifs and the receptor coactivator pocket.
20378690 2010 Genetic variants in selenoprotein genes increase risk of colorectal cancer.
20178852 2010 Association study between polymorphisms in selenoprotein genes and susceptibility to Kashin-Beck disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19896490 2010 Low 8-oxo-7,8-dihydro-2'-deoxyguanosine levels and influence of genetic background in an Andean population exposed to high levels of arsenic.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19617637 2009 Over-expression of a human chromosome 22q11.2 segment including TXNRD2, COMT and ARVCF developmentally affects incentive learning and working memory in mice.
19595745 2009 Modulation of thioredoxin reductase-2 expression in EAhy926 cells: implications for endothelial selenoprotein hierarchy.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19035188 2008 [Association of genetic polymorphisms in selenoprotein GPX1 and TXNRD2 with genetic susceptibility of gastric cancer].
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17707404 2007 Reconstitution of the mitochondrial PrxIII antioxidant defence pathway: general properties and factors affecting PrxIII activity and oligomeric state.
17634480 2007 Common germline genetic variation in antioxidant defense genes and survival after diagnosis of breast cancer.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17395017 2007 Reduced thioredoxin increases proinflammatory cytokines and neutrophil influx in rat airways: modulation by airway mucus.
16868544 2006 Interactions between genes involved in the antioxidant defence system and breast cancer risk.
16774913 2006 Characterization of alternative cytosolic forms and cellular targets of mouse mitochondrial thioredoxin reductase.
16424062 2006 Tagging single-nucleotide polymorphisms in antioxidant defense enzymes and susceptibility to breast cancer.
16298692 2005 Induction of apoptosis by the overexpression of an alternative splicing variant of mitochondrial thioredoxin reductase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12705894 2003 Involvements of mitochondrial thioredoxin reductase (TrxR2) in cell proliferation.
12530083 Overexpression of mitochondrial thioredoxin reductase and peroxiredoxin III in hepatocellular carcinomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12374691 2002 Thioredoxin reductase plays a critical role in IFN retinoid-mediated tumor-growth control in vivo.
11060283 2001 Heterogeneity within animal thioredoxin reductases. Evidence for alternative first exon splicing.
11012661 2000 Physiological functions of thioredoxin and thioredoxin reductase.
10608886 1999 Novel selenoproteins identified in silico and in vivo by using a conserved RNA structural motif.
10591208 1999 The DNA sequence of human chromosome 22.
10455115 1999 Redox regulation of cell signaling by selenocysteine in mammalian thioredoxin reductases.
10215850 1999 Human mitochondrial thioredoxin reductase cDNA cloning, expression and genomic organization.
9923614 1999 Cloning, sequencing and functional expression of a novel human thioredoxin reductase.