Property Summary

NCBI Gene PubMed Count 19
PubMed Score 153.66
PubTator Score 19.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
glioblastoma 5572 3.2e-04
medulloblastoma, large-cell 6234 4.8e-04
Disease Target Count Z-score Confidence
Vaginal discharge 7 4.147 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
glioblastoma 1.100 3.2e-04
medulloblastoma, large-cell 1.200 4.8e-04

Synonym

Accession Q9NX01 D3DWS6
Symbols DLP
Dim2

Gene

PDB

1XBS   3GIX   4IN0  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
23519793 A crystal structure of TXNL4B was determined at 1.33 A resolution and refined to an Rwork of 0.13 and an Rfree of 0.18 with one native dimer in the asymmetric unit.
22082156 Knockdown of thioredoxin-like 4B (TXNL4B) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
16511018 The human gene coding for the spliceosomal protein thioredoxin-like 4B (TXNL4B) was overexpressed in Escherichia coli and the encoded protein was purified and crystallized.
16142897 crystal structure; in contrast to hDim1, hDim2 forms stable homodimers
15161931 DLP is implicated in not only cell cycle progression but also in a more specific molecular process such as pre-mRNA splicing

AA Sequence

MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYT      1 - 70
QYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIP     71 - 140
KYDLLYQDI                                                                 141 - 149
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23519793 2013 High-resolution crystal structure of human Dim2/TXNL4B.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22403646 2012 A genome-wide association study identifies rs2000999 as a strong genetic determinant of circulating haptoglobin levels.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16511018 2005 Overproduction, purification, crystallization and preliminary X-ray diffraction studies of the human spliceosomal protein TXNL4B.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16142897 2005 Biochemical characterization and crystal structure of a Dim1 family associated protein: Dim2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15163659 2004 Biochemical and structural characterization of (South)-methanocarbathymidine that specifically inhibits growth of herpes simplex virus type 1 thymidine kinase-transduced osteosarcoma cells.
15161931 2004 DLP, a novel Dim1 family protein implicated in pre-mRNA splicing and cell cycle progression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11015569 1999 The evolutionarily conserved Dim1 protein defines a novel branch of the thioredoxin fold superfamily.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.