Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.05
PubTator Score 25.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Burn-Mckeown syndrome 3 0.0 0.0
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.600 7.4e-04
astrocytic glioma -1.900 5.4e-03
atypical teratoid / rhabdoid tumor -1.600 9.2e-04
diabetes mellitus -1.100 1.5e-03
ependymoma -1.800 1.9e-02
glioblastoma -1.600 1.8e-03
lung cancer 2.300 7.5e-05
Multiple myeloma 1.227 5.7e-04
osteosarcoma -1.662 1.4e-03
ovarian cancer 2.600 9.8e-06
psoriasis 1.600 1.3e-04

Gene RIF (5)

AA Sequence

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFN      1 - 70
KMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKY     71 - 140
RY                                                                        141 - 142
//

Text Mined References (24)

PMID Year Title