Property Summary

NCBI Gene PubMed Count 23
PubMed Score 224.68
PubTator Score 47.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.900 1.2e-04
atypical teratoid / rhabdoid tumor -3.100 2.1e-05
ependymoma -1.200 2.0e-05
glioblastoma -1.800 1.2e-04
group 3 medulloblastoma -1.100 1.0e-03
intraductal papillary-mucinous carcinoma... -1.600 2.8e-02
invasive ductal carcinoma -1.400 2.3e-03
medulloblastoma, large-cell -3.000 7.4e-05
Multiple myeloma 1.724 1.6e-04
non-small cell lung cancer -1.150 4.6e-17
osteosarcoma -1.354 3.1e-02
ovarian cancer -1.800 4.5e-08
pancreatic ductal adenocarcinoma liver m... -1.085 1.9e-02
pituitary cancer 1.100 2.2e-04
primitive neuroectodermal tumor -1.400 6.1e-04
Waldenstrons macroglobulinemia 1.484 1.9e-03

Gene RIF (10)

AA Sequence

MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAAT      1 - 70
NNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNE     71 - 140
SDEHGFDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAE    141 - 210
RSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKR    211 - 280
VVGKKGESH                                                                 281 - 289
//

Text Mined References (27)

PMID Year Title