Property Summary

NCBI Gene PubMed Count 142
PubMed Score 365.16
PubTator Score 185.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.56 1.8

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease -1.053 2.8e-02
astrocytoma 1.600 9.6e-16
Atopic dermatitis -1.400 1.5e-02
Breast cancer -2.400 2.6e-02
breast carcinoma -1.300 1.8e-16
chronic lymphosyte leukemia -1.100 1.2e-02
colon cancer -1.800 7.1e-03
cystic fibrosis 1.186 2.0e-05
Down syndrome 1.800 2.3e-03
ductal carcinoma in situ -1.700 7.8e-04
ependymoma 1.200 3.5e-04
fibroadenoma -1.200 3.0e-03
glioblastoma 1.500 2.9e-02
group 3 medulloblastoma 1.100 6.7e-03
Hydrolethalus syndrome 1.887 3.8e-02
invasive ductal carcinoma -1.700 1.2e-02
lung adenocarcinoma -1.800 1.0e-10
lung cancer -2.000 1.0e-05
malignant mesothelioma -3.100 1.0e-06
non-small cell lung cancer -1.192 2.2e-09
oligodendroglioma 2.200 5.1e-03
ovarian cancer -3.600 2.5e-11
pancreatic cancer -1.300 1.5e-04
pancreatic carcinoma -1.300 1.5e-04
Pick disease 1.300 1.5e-02
pituitary cancer -1.800 7.1e-03
primitive neuroectodermal tumor 1.100 8.8e-03
psoriasis -1.900 3.5e-04
tuberculosis 1.300 5.3e-05

PDB (11)

Gene RIF (133)

AA Sequence

MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYL      1 - 70
RYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETK     71 - 140
KNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVV    141 - 210
PKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYV    211 - 280
SVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTP    281 - 350
LLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ                                 351 - 391
//

Text Mined References (146)

PMID Year Title