Property Summary

NCBI Gene PubMed Count 38
PubMed Score 32.60
PubTator Score 35.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Protein-protein Interaction (5)

Gene RIF (26)

AA Sequence

MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADM      1 - 70
FTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLK     71 - 140
LFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFI    141 - 210
KFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGK    211 - 280
RDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWC    281 - 350
GHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL    351 - 420
HRFVLSQAKDEL                                                              421 - 432
//

Text Mined References (42)

PMID Year Title