Property Summary

NCBI Gene PubMed Count 35
PubMed Score 27.33
PubTator Score 35.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NBS9 B2RDM2 Q5TCQ0 Q8ND33 Q8TCT2 Q9BVH9
Symbols HCC2
ERP46
HCC-2
STRF8
PDIA15
UNQ364
ENDOPDI

Gene

PDB

2DIZ   3UJ1   3UVT   3WGD   3WGE   3WGX  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (9)

Gene RIF (23)

PMID Text
25500540 we defined an important role of TXNDC5 in CRPC and further investigations are needed to screen TXNDC5 antagonists as a novel therapeutic approaches to treat PCa patients with Castration-resistant prostate cancer.
24594673 suggest that the tumorigenic properties of ERp46 in RCC cells are not related to an inhibitory modulation of AdipoR1
24462249 Role of ERp46 in oxidative protein folding.Independent actions of ERp46 thioredoxin domains on folding substrates.Structure of thioredoxin ERp46 domains.
24103565 Endo-PDI is a novel, important mediator of AP-1-driven gene expression and endothelial angiogenic function.
24100949 TXNDC5 has increased expression in many tumors that is involved in the proliferation and migration of tumor cells, acting as a tumor-enhancing gene.
24023338 results suggest that TXNDC5 polymorphisms could be related to the development of HCC in the Korean male population
23713588 Hyperoxidized peroxiredoxin 2 interacts with the protein disulfide- isomerase ERp46.
23376096 Authors show that ERp46 is able to bind to a large pool of peptides containing aromatic and basic residues via all three of its catalytic domains (a(0), a and a'), though the a(0) domain may contain the primary binding site.
23326410 Hypoxia induced TXCNDC5 expression, which contributed to adiponectin expression, cytokine production and the cellular proliferation and migration of fibroblasts in rheumatoid arthritis.
22505402 crystal structure of the third catalytic domain of protein disulfide isomerase ERp46 (also known as protein disulfide isomerase A5 and TXNDC5) was determined to 2.0 A resolution
22190034 HIV-1 gp41 is identified to have a physical interaction with thioredoxin domain containing 5 (TXNDC5) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21801346 TXNDC5 has a genetic effect on the risk of rheumatoid arthritis and ankylosing spondylitis
21617212 Overexpression of the TXNDC5 protein is associated with non-small cell lung carcinoma.
20157732 TXNDC5 can promote the growth and proliferation of gastric cells. Silencing of TXNDC5 can restrain the growth and proliferation of gastric cancer cells.
20074551 these results establish ERp46 as the first AdipoR1-specific interacting protein and suggest a role for ERp46 in adiponectin receptor biology and adiponectin signalling.
19906073 results suggest that TXNDC5 gene polymorphisms are associated with the development of nonsegmental vitiligo in the Korean population.
19906073 Observational study of gene-disease association. (HuGE Navigator)
19887585 ERp46 has specificity towards peroxiredoxin-4, a thioredoxin peroxidase.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19694819 Observational study of gene-disease association. (HuGE Navigator)
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17895523 upregulation of TXNDC5 are involved in the early development of colorectal cancer
12963716 Member of the protein disulphide isomerase family and highly expressed in endothelial cells. Protects endothelial cells from apoptosis under hypoxia.

AA Sequence

MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADM      1 - 70
FTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLK     71 - 140
LFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFI    141 - 210
KFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGK    211 - 280
RDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWC    281 - 350
GHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL    351 - 420
HRFVLSQAKDEL                                                              421 - 432
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25500540 2015 The role of TXNDC5 in castration-resistant prostate cancer-involvement of androgen receptor signaling pathway.
24594673 2014 Endoplasmic reticulum protein ERp46 in renal cell carcinoma.
24462249 2014 Radically different thioredoxin domain arrangement of ERp46, an efficient disulfide bond introducer of the mammalian PDI family.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24103565 2013 Endo-PDI is required for TNF?-induced angiogenesis.
24100949 2013 Investigating a pathogenic role for TXNDC5 in tumors.
24023338 2013 TXNDC5 gene polymorphism contributes to increased risk of hepatocellular carcinoma in the Korean male population.
23713588 2013 Hyperoxidized peroxiredoxin 2 interacts with the protein disulfide- isomerase ERp46.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376096 2013 Peptide binding by catalytic domains of the protein disulfide isomerase-related protein ERp46.
23326410 2013 Investigate pathogenic mechanism of TXNDC5 in rheumatoid arthritis.
22505402 2012 Structure of the third catalytic domain of the protein disulfide isomerase ERp46.
21801346 2011 Investigating a pathogenic role for TXNDC5 in rheumatoid arthritis.
21617212 2011 Overexpression of the TXNDC5 protein in non-small cell lung carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21057456 2010 Recycling of peroxiredoxin IV provides a novel pathway for disulphide formation in the endoplasmic reticulum.
20157732 2010 The influence of TXNDC5 gene on gastric cancer cell.
20074551 2010 ERp46 binds to AdipoR1, but not AdipoR2, and modulates adiponectin signalling.
19906073 2010 Association of TXNDC5 gene polymorphisms and susceptibility to nonsegmental vitiligo in the Korean population.
19887585 2009 Protein disulphide isomerase family members show distinct substrate specificity: P5 is targeted to BiP client proteins.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19694819 2009 Clustering by neurocognition for fine mapping of the schizophrenia susceptibility loci on chromosome 6p.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17895523 2007 Differential expression of mimecan and thioredoxin domain-containing protein 5 in colorectal adenoma and cancer: a proteomic study.
16574106 2006 Hcc-2, a novel mammalian ER thioredoxin that is differentially expressed in hepatocellular carcinoma.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12963716 2003 EndoPDI, a novel protein-disulfide isomerase-like protein that is preferentially expressed in endothelial cells acts as a stress survival factor.
12930873 2003 ERp19 and ERp46, new members of the thioredoxin family of endoplasmic reticulum proteins.
12878160 2003 VIPL, a VIP36-like membrane protein with a putative function in the export of glycoproteins from the endoplasmic reticulum.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11252894 2000 Three ways to make a vesicle.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.