Property Summary

NCBI Gene PubMed Count 14
PubMed Score 42.68
PubTator Score 35.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma multiforme 1.200 9.6e-21
non-small cell lung cancer 1.139 4.4e-18
breast carcinoma 1.300 9.5e-05
psoriasis 1.400 5.8e-15
lung adenocarcinoma 1.500 1.3e-08
invasive ductal carcinoma 1.110 2.7e-03
ovarian cancer 1.700 1.8e-04

Synonym

Accession Q9BRA2 A8K7E8
Symbols TRP14
TXNL5

Gene

PANTHER Protein Class (1)

PDB

1WOU  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
26976343 found STAT3 could bind promoter region of TXNDC17 (-623 bp to -58 bp relative to the transcription start site (TSS)) for regulating its expression
25607466 TXNDC17, through participation of BECN1, induces autophagy and consequently results in paclitaxel resistance in ovarian cancer
24778250 The oxidoreductase activities of TRP14 thereby complement those of Trx1 and must therefore be considered for the full understanding of enzymatic control of cellular thiols and nitrosothiols.
18579519 LC8 binds IkappaBalpha in a redox-dependent manner and thereby prevents its phosphorylation by IKK. TRP14 contributes to this inhibitory activity by maintaining LC8 in a reduced state.
15355959 Data report the crystal structure of human thioredoxin-related protein 14 determined at 1.8-angstrom resolution.
14607844 TRP14 is a thioredoxin-related protein of 14 kDa
14607843 TRP14 is a thioredoxin-related protein with roles in tumor necrosis factor-alpha signaling pathways

AA Sequence

MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQ      1 - 70
VGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED                      71 - 123
//

Text Mined References (17)

PMID Year Title
26976343 2016 STAT3-dependent TXNDC17 expression mediates Taxol resistance through inducing autophagy in human colorectal cancer cells.
25607466 2015 TXNDC17 promotes paclitaxel resistance via inducing autophagy in ovarian cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24778250 2014 Thioredoxin-related protein of 14 kDa is an efficient L-cystine reductase and S-denitrosylase.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18579519 2008 Dynein light chain LC8 negatively regulates NF-kappaB through the redox-dependent interaction with IkappaBalpha.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355959 2004 Structural basis of cellular redox regulation by human TRP14.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14607844 2004 Identification and characterization of TRP14, a thioredoxin-related protein of 14 kDa. New insights into the specificity of thioredoxin function.
14607843 2004 Roles of TRP14, a thioredoxin-related protein in tumor necrosis factor-alpha signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.