Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.68
PubTator Score 4.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2843 1.2e-12
ovarian cancer 8520 4.8e-04
atypical teratoid / rhabdoid tumor 5112 5.1e-04
pituitary cancer 1972 8.9e-04
Pick disease 1894 3.3e-03
glioblastoma 5792 3.5e-03
Endometriosis 540 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 1.8
Disease Target Count Z-score Confidence
Meningioma 41 4.169 2.1

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 5.1e-04
Endometriosis -1.384 1.5e-02
glioblastoma -1.400 3.5e-03
lung carcinoma 1.200 1.2e-12
ovarian cancer -1.300 4.8e-04
Pick disease -1.200 3.3e-03
pituitary cancer 1.400 8.9e-04

Gene RIF (2)

AA Sequence

MFSGFNVFRVGISFVIMCIFYMPTVNSLPELSPQKYFSTLQPGKASLAYFCQADSPRTSVFLEELNEAVR      1 - 70
PLQDYGISVAKVNCVKEEISRYCGKEKDLMKAYLFKGNILLREFPTDTLFDVNAIVAHVLFALLFSEVKY     71 - 140
ITNLEDLQNIENALKGKANIIFSYVRAIGIPEHRAVMEAAFVYGTTYQFVLTTEIALLESIGSEDVEYAH    141 - 210
LYFFHCKLVLDLTQQCRRTLMEQPLTTLNIHLFIKTMKAPLLTEVAEDPQQVSTVHLQLGLPLVFIVSQQ    211 - 280
ATYEADRRTAEWVAWRLLGKAGVLLLLRDSLEVNIPQDANVVFKRAEEGVPVEFLVLHDVDLIISHVENN    281 - 350
MHIEEIQEDEDNDMEGPDIDVQDDEVAETVFRDRKRKLPLELTVELTEETFNATVMASDSIVLFYAGWQA    351 - 420
VSMAFLQSYIDVAVKLKGTSTMLLTRINCADWSDVCTKQNVTEFPIIKMYKKGENPVSYAGMLGTEDLLK    421 - 490
FIQLNRISYPVNITSIQEAEEYLSGELYKDLILYSSVSVLGLFSPTMKTAKEDFSEAGNYLKGYVITGIY    491 - 560
SEEDVLLLSTKYAASLPALLLARHTEGKIESIPLASTHAQDIVQIITDALLEMFPEITVENLPSYFRLQK    561 - 630
PLLILFSDGTVNPQYKKAILTLVKQKYLDSFTPCWLNLKNTPVGRGILRAYFDPLPPLPLLVLVNLHSGG    631 - 700
QVFAFPSDQAIIEENLVLWLKKLEAGLENHITILPAQEWKPPLPAYDFLSMIDAATSQRGTRKVPKCMKE    701 - 770
TDVQENDKEQHEDKSAVRKEPIETLRIKHWNRSNWFKEAEKSFRRDKELGCSKVN                   771 - 825
//

Text Mined References (13)

PMID Year Title