Property Summary

NCBI Gene PubMed Count 38
PubMed Score 125.20
PubTator Score 69.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
spina bifida 1074
Disease Target Count P-value
psoriasis 6694 2.5e-04
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 2.5e-04

Protein-protein Interaction (1)

Gene RIF (32)

AA Sequence

MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDF      1 - 70
QDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMK     71 - 140
NGDVVDKFVGIKDEDQLEAFLKKLIG                                                141 - 166
//

Text Mined References (44)

PMID Year Title