Property Summary

NCBI Gene PubMed Count 34
PubMed Score 119.35
PubTator Score 69.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
spina bifida 1064
Disease Target Count P-value
psoriasis 6685 2.5e-04
Disease Target Count Z-score Confidence
Neurodegenerative disease 383 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 2.5e-04

Protein-protein Interaction (2)

Gene RIF (28)

PMID Text
26041303 Thioredoxin 2 Is a Novel E2-Interacting Protein That Inhibits the Replication of Classical Swine Fever Virus by promoting the nuclear translocation of the p65 subunit of NF-kappaB.
24735978 CERKL interacts with TRX2 and plays a novel key role in the regulation of the TRX2 antioxidant pathway.
24342608 TGF-beta-mediated expression of the epithelial-mesenchymal transition marker fibronectin was inhibited not only by chemicals that interfere with reactive oxygen species signaling but also by exogenously expressed mitochondrial thioredoxin.
24295294 The Grx2 system could help to keep Trx2/1 reduced during an oxidative stress, thereby contributing to the anti-apoptotic signaling.
23485938 We showed that overexpression of TRXs reduced cell death; TRX2 was expressed in the mitochondria, while TRX1 was expressed in the cytoplasm.
21557999 knockdown of TRX-1 or TRX-2 sensitizes cells to CYP2E1-induced oxidant stress partially via ASK-1 and JNK1 signaling pathways. Both TRX-1 and TRX-2 are important for defense against CYP2E1-induced oxidative stress.
21327297 Data show that knockdown of S100P led to downregulation of thioredoxin 1 and beta-tubulin and upregulation of RhoGDIA, all potential therapeutic targets in cancer.
21158569 TRX1 and TRX2 regulate the proliferation and survival of adipocyte derived stem cells; these processes are mediated by the activation of ERK1/2
20929858 Both thioredoxin 2 and glutaredoxin 2 contribute to the reduction of the mitochondrial 2-Cys peroxiredoxin Prx3.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19885567 These results suggest that TRX2 not only functions as an antioxidant, but also supports mtTFA functions
19570036 Trx2 modulates transcription of GR and NF-kappaB reporter genes.
19165900 a novel Ins/Del polymorphism in the human TXN2 gene proximal promoter region that altered the transcriptional activity and is associated with spina bifida risk
19165900 Observational study of gene-disease association. (HuGE Navigator)
19135121 Report the effects of acrolein on peroxiredoxins, thioredoxins, and thioredoxin reductase in human bronchial epithelial cells.
19124506 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18497292 upon stimulation of Fas, thioredoxin-2 mediated denitrosylation of mitochondria-associated caspase-3, a process required for caspase-3 activation, and promoted apoptosis
17939155 The LC/ICPMS analyses showed that the trivalent arsenic species were able to form complexes with both human and E. coli Trx.
17634480 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
17548047 The additive protection by Trx2 and GSH shows that Trx2 and GSH systems are both functionally important at low oxidative stress conditions.
17220299 Thioredoxin 1 and thioredoxin 2 have opposed regulatory functions on hypoxia-inducible factor-1alpha.
16868544 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16424062 Observational study of gene-disease association. (HuGE Navigator)
12080052 MT-TRX has a role in the regulation of the mitochondrial membrane potential and cell death
12032145 mitochondrial thioredoxin may play important roles in protection against oxidant-induced apoptosis

AA Sequence

MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDF      1 - 70
QDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMK     71 - 140
NGDVVDKFVGIKDEDQLEAFLKKLIG                                                141 - 166
//

Text Mined References (40)

PMID Year Title
26626369 2016 Human thioredoxin 2 deficiency impairs mitochondrial redox homeostasis and causes early-onset neurodegeneration.
26041303 2015 Thioredoxin 2 Is a Novel E2-Interacting Protein That Inhibits the Replication of Classical Swine Fever Virus.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24735978 2014 CERKL interacts with mitochondrial TRX2 and protects retinal cells from oxidative stress-induced apoptosis.
24342608 2014 A mitochondrial thioredoxin-sensitive mechanism regulates TGF-?-mediated gene expression associated with epithelial-mesenchymal transition.
24295294 2014 Glutaredoxin 2 reduces both thioredoxin 2 and thioredoxin 1 and protects cells from apoptosis induced by auranofin and 4-hydroxynonenal.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23485938 2013 Different anti-oxidant effects of thioredoxin 1 and thioredoxin 2 in retinal epithelial cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21557999 2011 Depletion of cytosolic or mitochondrial thioredoxin increases CYP2E1-induced oxidative stress via an ASK-1-JNK1 pathway in HepG2 cells.
21327297 2011 Targeting S100P inhibits colon cancer growth and metastasis by Lentivirus-mediated RNA interference and proteomic analysis.
21158569 2011 Role of thioredoxin 1 and thioredoxin 2 on proliferation of human adipose tissue-derived mesenchymal stem cells.
20929858 2010 Both thioredoxin 2 and glutaredoxin 2 contribute to the reduction of the mitochondrial 2-Cys peroxiredoxin Prx3.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19885567 2009 Thioredoxin2 enhances the damaged DNA binding activity of mtTFA through direct interaction.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19570036 2009 Interaction of mitochondrial thioredoxin with glucocorticoid receptor and NF-kappaB modulates glucocorticoid receptor and NF-kappaB signalling in HEK-293 cells.
19165900 2009 Genetic polymorphisms in the thioredoxin 2 (TXN2) gene and risk for spina bifida.
19135121 2009 The effects of acrolein on peroxiredoxins, thioredoxins, and thioredoxin reductase in human bronchial epithelial cells.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18497292 2008 Regulated protein denitrosylation by cytosolic and mitochondrial thioredoxins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17939155 2007 Study of interactions between arsenicals and thioredoxins (human and E. coli) using mass spectrometry.
17634480 2007 Common germline genetic variation in antioxidant defense genes and survival after diagnosis of breast cancer.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17548047 2007 Mitochondrial thioredoxin-2/peroxiredoxin-3 system functions in parallel with mitochondrial GSH system in protection against oxidative stress.
17220299 2007 Thioredoxin 1 and thioredoxin 2 have opposed regulatory functions on hypoxia-inducible factor-1alpha.
16868544 2006 Interactions between genes involved in the antioxidant defence system and breast cancer risk.
16424062 2006 Tagging single-nucleotide polymorphisms in antioxidant defense enzymes and susceptibility to breast cancer.
16195549 2005 Crystal structures of oxidized and reduced forms of human mitochondrial thioredoxin 2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080052 2002 Human mitochondrial thioredoxin. Involvement in mitochondrial membrane potential and cell death.
12032145 2002 Overexpressed human mitochondrial thioredoxin confers resistance to oxidant-induced apoptosis in human osteosarcoma cells.
10591208 1999 The DNA sequence of human chromosome 22.