Property Summary

NCBI Gene PubMed Count 34
PubMed Score 11.01
PubTator Score 10.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.800 2.4e-04
glioblastoma multiforme 1.100 4.5e-19
astrocytoma 2.000 5.3e-03
intraductal papillary-mucinous adenoma (... 1.100 1.9e-02
pilocytic astrocytoma 1.100 1.1e-06
ovarian cancer 1.200 8.3e-04

Gene RIF (12)

PMID Text
26527738 Silencing of alpha-taxilin expression leads to increased release of infectious hepatitis C virus particles.
25940130 intrathyroidal production of IL-14 and IL-16 associated with the pathogenesis of autoimmune thyroid disease
24690921 alpha-taxilin interacts with SNX4 and plays a role in the recycling pathway of TfnR.
23816704 alpha-taxilin plays an essential role for release of HBV-DNA containing particles.
22785156 Alpha-taxilin is localized on intracellular components in a syntaxin-independent manner and that the alpha-taxilin-containing intracellular components are associated with the microtubule cytoskeleton.
21551945 Increased alpha-taxilin protein expression is associated with the metastatic and invasive potential of renal cell cancer.
21042709 alpha-taxilin may be involved in cell proliferation of hepatocellular carcinoma(HCC), and its expression can be a marker of malignant potential of HCC.
19663695 analysis of a novel monoclonal antibody against interleukin-14alpha
19038581 IL-14a is important in the pathophysiology of Sjogren's disease
18645499 increases in IL-14 transcript levels may play a role in alloantibody formation after renal transplantation
17015757 role for IL-14alpha (Txln gene product)in the development of both autoimmunity and lymphomagenesis
15184072 identification of isoforms; interaction with syntaxin [alpha-taxilin]

AA Sequence

MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRD      1 - 70
VSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDP     71 - 140
NTEEIRQSDEVGDRDHRRPQEKKKAKGLGKEITLLMQTLNTLSTPEEKLAALCKKYAELLEEHRNSQKQM    141 - 210
KLLQKKQSQLVQEKDHLRGEHSKAVLARSKLESLCRELQRHNRSLKEEGVQRAREEEEKRKEVTSHFQVT    211 - 280
LNDIQLQMEQHNERNSKLRQENMELAERLKKLIEQYELREEHIDKVFKHKDLQQQLVDAKLQQAQEMLKE    281 - 350
AEERHQREKDFLLKEAVESQRMCELMKQQETHLKQQLALYTEKFEEFQNTLSKSSEVFTTFKQEMEKMTK    351 - 420
KIKKLEKETTMYRSRWESSNKALLEMAEEKTVRDKELEGLQVKIQRLEKLCRALQTERNDLNKRVQDLSA    421 - 490
GGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQEPTSARA                  491 - 546
//

Text Mined References (47)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26527738 2016 Characterization of ?-taxilin as a novel factor controlling the release of hepatitis C virus.
25940130 2015 IL-14 and IL-16 are expressed in the thyroid of patients with either Graves' disease or Hashimoto's thyroiditis.
25416956 2014 A proteome-scale map of the human interactome network.
24690921 2014 ?-Taxilin interacts with sorting nexin 4 and participates in the recycling pathway of transferrin receptor.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23816704 2013 Identification of ?-taxilin as an essential factor for the life cycle of hepatitis B virus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22785156 2012 Interaction of ?-taxilin localized on intracellular components with the microtubule cytoskeleton.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21551945 2011 Increased alpha-taxilin protein expression is associated with the metastatic and invasive potential of renal cell cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21042709 2010 Expression of ?-taxilin in hepatocellular carcinoma correlates with growth activity and malignant potential of the tumor.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19663695 2009 Characteristics of a novel monoclonal antibody against interleukin-14alpha.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19038581 2009 IL-14 alpha, the nexus for primary Sjögren's disease in mice and humans.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18645499 2008 Regulation of human interleukin 14 transcription in vitro and in vivo after renal transplantation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17015757 2006 Development of autoimmunity in IL-14alpha-transgenic mice.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15184072 2004 Identification and characterization of taxilin isoforms.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623251 2003 Interaction of taxilin with syntaxin which does not form the SNARE complex.
12558796 2003 Taxilin; a novel syntaxin-binding protein that is involved in Ca2+-dependent exocytosis in neuroendocrine cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9110174 1997 Large-scale concatenation cDNA sequencing.
8755619 1996 Identification of a cDNA for a human high molecular-weight B-cell growth factor.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8327514 1993 Identification of a cDNA for a human high-molecular-weight B-cell growth factor.