Property Summary

Ligand Count 17
NCBI Gene PubMed Count 25
PubMed Score 191.09
PubTator Score 294.26

Knowledge Summary

Patent (50,553)

Expression

  Differential Expression (4)

Disease log2 FC p
Common variable immunodeficiency -1.421 2.1e-02
lung carcinoma -1.500 1.9e-20
malignant mesothelioma -1.900 1.1e-06
osteosarcoma -1.760 2.1e-03

Gene RIF (8)

AA Sequence

MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSNTGRVQPSKRK      1 - 70
PLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWWKARDRLGNEGLIPSNYVTEN     71 - 140
KITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDS    141 - 210
GQWYVAERHAFQSIPELIWYHQHNAAGLMTRLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSG    211 - 280
QFGVVHLGEWRSHIQVAIKAINEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGC    281 - 350
LLNYLRENKGKLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY    351 - 420
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISEGFRLYRPHL    421 - 490
APMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW                                     491 - 527
//

Text Mined References (28)

PMID Year Title