Property Summary

NCBI Gene PubMed Count 18
PubMed Score 265.83
PubTator Score 68.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -2.400 1.7e-08
glioblastoma multiforme 1.500 4.7e-17
osteosarcoma 1.501 2.3e-03
ependymoma 1.500 6.1e-14
atypical teratoid / rhabdoid tumor 1.900 1.5e-05
primary pancreatic ductal adenocarcinoma 1.321 3.0e-02
active Crohn's disease 1.980 2.3e-03
active ulcerative colitis 1.175 1.5e-02
Breast cancer 2.800 2.8e-02
pilocytic astrocytoma 1.300 1.3e-05
nasopharyngeal carcinoma 1.300 5.2e-03
progressive supranuclear palsy -1.100 1.2e-02
ovarian cancer -1.500 7.7e-04

Gene RIF (5)

PMID Text
26517884 Data suggest CHRD (chordin) cleavage by tolloid-like metalloproteinases is insufficient to regulate BMP(bone morphogenetic protein)/BMPR signaling; CHRD fragments and TSG (twisted gastrulation protein) contribute to inhibition of BMP/BMPR signaling.
23641068 these results suggest that BMPER and Tsg maintain a fine-tuned equilibrium that controls BMP pathway activity and is necessary for vascular cell homeostasis.
21227728 mutations in the twisted gastrulation homolog 1 gene are neither a common direct cause nor a frequent modifying factor for human holoprosencephaly pathologies
19414861 interferes with BMP-mediated hepcidin expression and may act with GDF15 to dysregulate iron homeostasis in thalassemia syndromes.
17164348 Tsg functions as an agonist synergizing with TGF-beta to inhibit T-cell activation.

AA Sequence

MKLHYVAVLTLAILMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDEC      1 - 70
CDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETV     71 - 140
NQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECID    141 - 210
YGSKTVKCMNCMF                                                             211 - 223
//

Text Mined References (20)

PMID Year Title
26517884 2015 The role of chordin fragments generated by partial tolloid cleavage in regulating BMP activity.
25416956 2014 A proteome-scale map of the human interactome network.
23641068 2013 Antagonism and synergy between extracellular BMP modulators Tsg and BMPER balance blood vessel formation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
21227728 2011 Minimal evidence for a direct involvement of twisted gastrulation homolog 1 (TWSG1) gene in human holoprosencephaly.
19414861 2009 Identification of TWSG1 as a second novel erythroid regulator of hepcidin expression in murine and human cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17164348 2007 Twisted gastrulation (Tsg) is regulated by Tob and enhances TGF-beta signaling in activated T lymphocytes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14681194 2004 Inactivation of mouse Twisted gastrulation reveals its role in promoting Bmp4 activity during forebrain development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12119341 2002 The developmentally regulated expression of Twisted gastrulation reveals a role for bone morphogenetic proteins in the control of T cell development.
11420619 2001 Evolutionary conservation, developmental expression, and genomic mapping of mammalian Twisted gastrulation.
11260715 2001 Homologues of Twisted gastrulation are extracellular cofactors in antagonism of BMP signalling.
10866189 2000 The evolutionarily conserved BMP-binding protein Twisted gastrulation promotes BMP signalling.