Property Summary

NCBI Gene PubMed Count 51
PubMed Score 148.07
PubTator Score 68.22

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (38)

AA Sequence

MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL      1 - 70
ANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHER     71 - 140
LSYAFSVWRMEGAWSMSASH                                                      141 - 160
//

Text Mined References (51)

PMID Year Title