Property Summary

NCBI Gene PubMed Count 50
PubMed Score 151.83
PubTator Score 68.22

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (37)

PMID Text
27048119 TWIST2 regulates epithelial-mesenchymal transition by depriving the epithelial cell phenotype of E-cadherin and endowing the mesenchymal cell phenotype with Vimentin, which may be involved in the progression and prognosis of ovarian cancer.
26842802 Findings indicated that HIF-2alpha promotes epithelial-mesenchymal transition in pancreatic cancer by regulating Twist2 binding to the promoter of E-cadherin.
26119818 A substituted lysine at TWIST2 residue 75 results in Ablepharon Macrostomia Syndrome, whereas a glutamine or alanine yields Barber-Say Syndrome.
26019273 After chronic NOD2 stimulation, Twist1 and Twist2 coordinate the regulation of both transcriptional activators and repressors, thereby mediating optimal cytokine down-regulation.
25895023 MACC1 promotes vasculogenic mimicry in gastric cancer by regulating the HGF/c-Met-TWIST1/2 signaling pathway.
25728400 In patients with no duplication/triplication of the 1p36.22p36.21 region and no mutations in TWIST2, there are mutation(s) in one of the 30 genes in this region or mutations in other as yet unidentified genes at different locations
25663706 TWIST1 and TWIST2 are expressed in skeletal muscle and remained unaltered in metabolic diseases.
25608809 Twist2 plays roles in osteogenesis differentiation, tumor formation and epithelial-mesenchymal transition.[review]
25528769 Data suggest that TWIST1 and to a lesser degree TWIST2 expressed within the tumor stroma could contribute to the epithelial-mesenchymal transition (EMT)-like tumor budding phenotype in colorectal cancers.
25420506 Results show that Twist2 expression was gradually increased during the progression from normal cervical squamous epithelium to cervical intraepithelial neoplasia (CIN) and cervical squamous cell carcinoma.
25410422 A homozygous missense mutation in the TWIST2 gene was described in 3 siblings affected by Setleis syndrome. An alteration of bHLH domain, and loss of transcription factor's function was predicted due to protein substitution.
25088197 Data have identified a novel TWIST2-p21 axis that regulates the cell cycle of both normal and leukemic hematopoietic cells, which implicates TWIST2 as a novel tumor suppressor in human acute myeloid leukemia.
24982420 LPS promotes PDCD4 degradation via a pathway involving PI3K and mTOR, releasing Twist2, which induces IL-10 via c-Maf.
24974259 Twist2 is the key Twist isoform coupling aberrant signals from pithelial-mesenchymal transition (EMT) to senescence and is an important candidate biomarker for cervical cancer prognosis.
24244294 nuclear beta-catenin is accumulated in Twist2-induced EMT cells to facilitates ovarian cancer invasion and metastasis.
24193512 identification of the Twist2-CD24 signaling pathway provides a potential therapeutic approach to target cancer stem cells in HCCs
24171926 These data highlight a pivotal role for miR-138 in the regulation of colorectal cancer metastasis by targeting TWIST2.
23763516 Data indicate that the expression of Twist2 and Runx2 differs significantly in mesenchymal stromal cells from bone marrow (bmMSC) compared to MSC from term placenta (pMSC).
23133563 heterogeneous expression of Twist2 in breast tumors may have a functional link to tumor progression
22201613 upregulation of TWIST2, correlated with poor differentiation grade and shorter survival and identifies a subset of node-positive oral cavity/pharynx cancer patients with very poor prognosis
22103974 Elevated expression of TWIST2 can contribute to invasion and metastasis of adenoid cystic carcinoma (ACC), and there might be some correlation between the hypoxia microenvironment and epithelial-mesenchymal transition in ACC.
22058208 This study suggests a dual role for epigenetic inactivation of TWIST2 in acute lymphoblastic leukemia, initially through altering cell growth and survival properties and subsequently by increasing resistance to chemotherapy.
22018873 TWIST2 overexpression was linked to cervix cancer progression, which makes it a promising marker for determining the metastatic potential.
21931173 Mexican-Nahua sibs with facial and ophthalmologic features of FFDD type III were evaluated. Genomic DNAs were isolated for sequencing of the TWIST2 gene. The affected sibs were homozygous for a novel TWIST2 frameshift mutation, c.168delC (p.S57AfsX45).
21866569 Twist1 and Twist2 modulate ATF4-dependent transcriptional activity in response to Parathyroid hormone.
21801849 these data suggest that the C-terminal domain of TWIST2, which is missing in the Q119X mutant form of TWIST2, is responsible for proper transactivation of the periostin gene.
21738662 Study correlates reduced TWIST2 and OPG expression with increased osteocalcin levels, thereby linking altered bone remodeling to energy homeostasis in hereditary HGPS.
21602879 overexpression of Twist2 may contribute to breast cancer progression by activating the epithelial to mesenchymal transition programme and enhancing the self-renewal of cancer stem-like cells.
21167768 overexpression of HIF-1alpha, TWIST2 or SNIP1 correlated with poor disease-free survival in patients with tongue squamous cell carcinoma
21109964 Our data implicate dermo1 as a tumor suppressor gene and a valuable molecular marker for human cancer
20691403 TWIST2 recessive mutations cause an focal facial dermal dysplasias and dominant TWIST1 mutations cause Saethre-Chotzen craniocynostosis suggests that they function independently in skin and bone development.
19937140 increased expression in T-cell is associated with resistance to apoptosis and tumor progression
19644484 hypoxic TWIST1 induction is regulated by both HIF-1 and HIF-2 proteins through distinct regulatory elements in a tissue-specific manner
19453261 Observational study of gene-disease association. (HuGE Navigator)
18598946 Twist proteins promote malignant conversion and metastatic dissemination.
17487558 findings suggest that reduced expression of TWIST suppresses the multistep process of peritoneal dissemination (detachment from the primary lesion, adhesion to MCs and invasion of MCs).
15809452 Epigenetic silencing of TWIST2 in mutated Ig V(H)is associated with chronic lymphocytic leukemia

AA Sequence

MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL      1 - 70
ANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHER     71 - 140
LSYAFSVWRMEGAWSMSASH                                                      141 - 160
//

Text Mined References (50)

PMID Year Title
27048119 2016 Role of TWIST2, E-cadherin and Vimentin in epithelial ovarian carcinogenesis and prognosis and their interaction in cancer progression.
26842802 2016 HIF-2? promotes epithelial-mesenchymal transition through regulating Twist2 binding to the promoter of E-cadherin in pancreatic cancer.
26119818 2015 Recurrent Mutations in the Basic Domain of TWIST2 Cause Ablepharon Macrostomia and Barber-Say Syndromes.
26019273 2015 Twist1 and Twist2 Contribute to Cytokine Downregulation following Chronic NOD2 Stimulation of Human Macrophages through the Coordinated Regulation of Transcriptional Repressors and Activators.
25895023 2015 Metastasis-associated in colon cancer-1 promotes vasculogenic mimicry in gastric cancer by upregulating TWIST1/2.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25728400 2015 Chromosome 1p36.22p36.21 duplications/triplication causes Setleis syndrome (focal facial dermal dysplasia type III).
25663706 2015 TWIST1 and TWIST2 regulate glycogen storage and inflammatory genes in skeletal muscle.
25608809 2015 Biological function and molecular mechanism of Twist2.
25528769 2015 TWIST1 and TWIST2 promoter methylation and protein expression in tumor stroma influence the epithelial-mesenchymal transition-like tumor budding phenotype in colorectal cancer.
25420506 2015 The indicative function of Twist2 and E-cadherin in HPV oncogene-induced epithelial-mesenchymal transition of cervical cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25410422 2015 Setleis syndrome: clinical, molecular and structural studies of the first TWIST2 missense mutation.
25088197 2015 Regulation of p21 by TWIST2 contributes to its tumor-suppressor function in human acute myeloid leukemia.
24982420 2014 LPS induces the degradation of programmed cell death protein 4 (PDCD4) to release Twist2, activating c-Maf transcription to promote interleukin-10 production.
24974259 2014 Twist2, the key Twist isoform related to prognosis, promotes invasion of cervical cancer by inducing epithelial-mesenchymal transition and blocking senescence.
24244294 2013 The role of nuclear ?-catenin accumulation in the Twist2-induced ovarian cancer EMT.
24193512 2014 Twist2 promotes self-renewal of liver cancer stem-like cells by regulating CD24.
24171926 2013 Down-regulation of miR-138 promotes colorectal cancer metastasis via directly targeting TWIST2.
23763516 2013 Low osteogenic differentiation potential of placenta-derived mesenchymal stromal cells correlates with low expression of the transcription factors Runx2 and Twist2.
23613636 2013 Twist2 is a valuable prognostic biomarker for colorectal cancer.
23133563 2012 Significance of heterogeneous Twist2 expression in human breast cancers.
22201613 2011 Overexpression of TWIST2 correlates with poor prognosis in head and neck squamous cell carcinomas.
22103974 2012 Coexpression of hypoxia-inducible factor-2?, TWIST2, and SIP1 may correlate with invasion and metastasis of salivary adenoid cystic carcinoma.
22058208 2012 Epigenetic inactivation of TWIST2 in acute lymphoblastic leukemia modulates proliferation, cell survival and chemosensitivity.
22018873 2012 Correlation of TWIST2 up-regulation and epithelial-mesenchymal transition during tumorigenesis and progression of cervical carcinoma.
21931173 2011 Setleis syndrome in Mexican-Nahua sibs due to a homozygous TWIST2 frameshift mutation and partial expression in heterozygotes: review of the focal facial dermal dysplasias and subtype reclassification.
21866569 2012 The basic helix loop helix transcription factor Twist1 is a novel regulator of ATF4 in osteoblasts.
21801849 2011 Nonsense mutations of the bHLH transcription factor TWIST2 found in Setleis Syndrome patients cause dysregulation of periostin.
21738662 2011 Discordant gene expression signatures and related phenotypic differences in lamin A- and A/C-related Hutchinson-Gilford progeria syndrome (HGPS).
21602879 2011 Twist2 contributes to breast cancer progression by promoting an epithelial-mesenchymal transition and cancer stem-like cell self-renewal.
21167768 2011 Hypoxia-inducible factor-1 alpha, in association with TWIST2 and SNIP1, is a critical prognostic factor in patients with tongue squamous cell carcinoma.
21109964 2011 Differential methylation of CpG islands within the dermo1 gene promoter in several cancer cell lines.
20691403 2010 Homozygous nonsense mutations in TWIST2 cause Setleis syndrome.
19937140 2009 Twist2 regulates CD7 expression and galectin-1-induced apoptosis in mature T-cells.
19644484 2009 It takes two to Twist.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18598946 2008 Induction of EMT by twist proteins as a collateral effect of tumor-promoting inactivation of premature senescence.
17487558 2007 Possible involvement of TWIST in enhanced peritoneal metastasis of epithelial ovarian carcinoma.
15809452 2005 TWIST2 demonstrates differential methylation in immunoglobulin variable heavy chain mutated and unmutated chronic lymphocytic leukemia.
15735646 2005 Altered Twist1 and Hand2 dimerization is associated with Saethre-Chotzen syndrome and limb abnormalities.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15030764 2004 A twist code determines the onset of osteoblast differentiation.
14654692 2003 Twist2, a novel ADD1/SREBP1c interacting protein, represses the transcriptional activity of ADD1/SREBP1c.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11809751 2002 Dermo-1, a multifunctional basic helix-loop-helix protein, represses MyoD transactivation via the HLH domain, MEF2 interaction, and chromatin deacetylation.
11062344 2000 Human Dermo-1 has attributes similar to twist in early bone development.
10524757 1998 Sequencing analysis of forty-eight human image cDNA clones similar to Drosophila mutant protein.
9061034 1997 The locations of the H-twist and H-dermo-1 genes are distinct on the human genome.
7589808 1995 Dermo-1: a novel twist-related bHLH protein expressed in the developing dermis.