Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.13
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVYLLCGLLSSSFITCMVTIIL      1 - 70
LLSCDFWAVKNVTGRLMVGLRWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACPVLWVI     71 - 140
FAFSALFSFRVKWLAVVIMGVVLQGANLYGYIRCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS         141 - 205
//

Text Mined References (8)

PMID Year Title