Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.13
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NYZ1 A8K448 Q96HK5 Q9Y3E6
Symbols FAM18B
NPD008
CGI-148
FAM18B1
YDR084C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVYLLCGLLSSSFITCMVTIIL      1 - 70
LLSCDFWAVKNVTGRLMVGLRWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACPVLWVI     71 - 140
FAFSALFSFRVKWLAVVIMGVVLQGANLYGYIRCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS         141 - 205
//

Text Mined References (8)

PMID Year Title