Property Summary

NCBI Gene PubMed Count 22
PubMed Score 47.88
PubTator Score 23.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7766 1.5e-06
non primary Sjogren syndrome sicca 861 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Perlman syndrome 8 5.309 2.7
Sleeping sickness 37 4.114 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 1.8e-02
osteosarcoma -1.115 1.5e-06

Gene RIF (13)

AA Sequence

MAAVDSDVESLPRGGFRCCLCHVTTANRPSLDAHLGGRKHRHLVELRAARKAQGLRSVFVSGFPRDVDSA      1 - 70
QLSEYFLAFGPVASVVMDKDKGVFAIVEMGDVGAREAVLSQSQHSLGGHRLRVRPREQKEFQSPASKSPK     71 - 140
GAAPDSHQLAKALAEAADVGAQMIKLVGLRELSEAERQLRSLVVALMQEVFTEFFPGCVVHPFGSSINSF    141 - 210
DVHGCDLDLFLDLGDLEEPQPVPKAPESPSLDSALASPLDPQALACTPASPPDSQPPASPQDSEALDFET    211 - 280
PSSSLAPQTPDSALASETLASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRG    281 - 350
CVPGVYRVQTVPSARRPVVKFCHRPSGLHGDVSLSNRLALHNSRFLSLCSELDGRVRPLVYTLRCWAQGR    351 - 420
GLSGSGPLLSNYALTLLVIYFLQTRDPPVLPTVSQLTQKAGEGEQVEVDGWDCSFPRDASRLEPSINVEP    421 - 490
LSSLLAQFFSCVSCWDLRGSLLSLREGQALPVAGGLPSNLWEGLRLGPLNLQDPFDLSHNVAANVTSRVA    491 - 560
GRLQNCCRAAANYCRSLQYQRRSSRGRDWGLLPLLQPSSPSSLLSATPIPLPLAPFTQLTAALVQVFREA    561 - 630
LGCHIEQATKRTRSEGGGTGESSQGGTSKRLKVDGQKNCCEEGKEEQQGCAGDGGEDRVEEMVIEVGEMV    631 - 700
QDWAMQSPGQPGDLPLTTGKHGAPGEEGQPSHAALAERGPKGHEAAQEWSQGEAGKGASLPSSASWRCAL    701 - 770
WHRVWQGRRRARRRLQQQTKEGAGGGAGTRAGWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPAD    771 - 840
RMLTVTPLQDPQGLFPDLHHFLQVFLPQAIRHLK                                        841 - 874
//

Text Mined References (23)

PMID Year Title