Property Summary

NCBI Gene PubMed Count 33
PubMed Score 72.82
PubTator Score 65.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.600 2.6e-03
oligodendroglioma -1.200 5.8e-03
psoriasis 1.100 5.2e-04
glioblastoma multiforme -1.600 5.7e-10
osteosarcoma 1.639 2.8e-02
atypical teratoid/rhabdoid tumor 1.500 8.0e-05
Duchenne muscular dystrophy 1.182 2.4e-08
intraductal papillary-mucinous adenoma (... -2.300 3.7e-04
lung cancer 2.800 1.2e-06
Breast cancer 2.800 3.1e-02
interstitial cystitis -2.000 4.5e-04
adult high grade glioma -2.300 2.6e-04
aldosterone-producing adenoma -1.144 2.2e-02
subependymal giant cell astrocytoma -1.274 3.7e-02
lung carcinoma 1.400 6.3e-15
Pick disease -1.600 2.1e-03
ulcerative colitis 1.500 2.9e-02
ovarian cancer -2.200 4.3e-06

Gene RIF (18)

PMID Text
26871953 decreased immunological TUSC3 staining is a factor prognostic of poor survival in pancreatic cancer patients.
26427135 Report frequencies of short tandem repeat markers linked to TUSC3 (MRT7) or NSUN2 (MRT5) genes used for homozygosity mapping of recessive intellectual disability.
25966277 The TUSC3 gene is associated with mental retardation in the Qinba mountain area in China; the sixth exon of the TUSC3 gene may contribute to the risk of developing the disease.
25735931 Loss of TUSC3 alters the molecular response to endoplasmic reticulum stress.
25086101 IGFII and N33 methylation status may be related to gastric carcinogenesis.
24685145 TUSC3 increases glycosylation efficiency for a subset of human glycoproteins by slowing glycoprotein folding.
24435307 TUSC3 loss alters the ER stress response and accelerates prostate cancer growth in vivo
23825019 Homozygous deletion in TUSC3 causes syndromic intellectual disability.
23404293 TUSC3 is a tumor suppressor gene in ovarian cancer.
21739581 A novel nonsense mutation in TUSC3 is responsible for non-syndromic autosomal recessive mental retardation
21557188 Genotyping and linkage analysis excluded linkage of the GRIK2 gene and TUSC3 gene with mental retardation.
21513506 analysis of a novel deletion mutation in the TUSC3 gene in a consanguineous Pakistani family that may have a role in autosomal recessive nonsyndromic intellectual
20505342 These findings suggest that inactivation through methylation of the putative tumor suppressor genes N-33 may not be associated with colorectal carcinogenesis in UC.
19717468 Knockdown of either MagT1 or TUSC3 protein significantly lowers the total and free intracellular Mg(2+) concentrations in cell lines.
18455129 study shows that mutations in two OTase-subunit genes, N33/TUSC3 and IAP result in autosomal-recessive nonsyndromic mental retardation
18452889 TUSC3 is only the fifth gene implicated in NS-ARMR and the first for which mutations have been reported in more than one family.
17641416 N33, STK11 (19p13) and TP53 might play a role in the development of metastasis in larynx and pharynx squamous cell carcinomas.
16270321 Down regulated in ovarian cancer or absent in ovarian cancer and impact survival.

AA Sequence

MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNG      1 - 70
DKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVF     71 - 140
QQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSL    141 - 210
VGGLLYLRRNNLEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAE    211 - 280
SHIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSDLDFE      281 - 348
//

Text Mined References (34)

PMID Year Title
26871953 2016 Decreased TUSC3 Promotes Pancreatic Cancer Proliferation, Invasion and Metastasis.
26427135 2015 Frequencies of Six (Five Novel) STR Markers Linked to TUSC3 (MRT7) or NSUN2 (MRT5) Genes Used for Homozygosity Mapping of Recessive Intellectual Disability.
25966277 2015 Association of TUSC3 gene polymorphisms with non-syndromic mental retardation based on nuclear families in the Qinba mountain area of China.
25735931 2015 Tumor suppressor candidate 3 (TUSC3) prevents the epithelial-to-mesenchymal transition and inhibits tumor growth by modulating the endoplasmic reticulum stress response in ovarian cancer cells.
25086101 2014 Methylation status of blood leukocyte DNA and risk of gastric cancer in a high-risk Chinese population.
24685145 2014 Structural basis of substrate specificity of human oligosaccharyl transferase subunit N33/Tusc3 and its role in regulating protein N-glycosylation.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24435307 2014 TUSC3 loss alters the ER stress response and accelerates prostate cancer growth in vivo.
23825019 2013 Homozygous deletion in TUSC3 causing syndromic intellectual disability: a new patient.
23594818 2013 Evidence for shared genetic risk between methamphetamine-induced psychosis and schizophrenia.
23404293 2013 Loss of the oligosaccharyl transferase subunit TUSC3 promotes proliferation and migration of ovarian cancer cells.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22449649 2012 Genome-wide association study of intelligence: additive effects of novel brain expressed genes.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
21739581 2011 A novel nonsense mutation in TUSC3 is responsible for non-syndromic autosomal recessive mental retardation in a consanguineous Iranian family.
21557188 2011 Non-syndromic autosomal recessive mental retardation in Tunisian families : exclusion of GRIK2 and TUSC3 genes.
21513506 2011 A novel deletion mutation in the TUSC3 gene in a consanguineous Pakistani family with autosomal recessive nonsyndromic intellectual disability.
20505342 2010 DNA methylation of ESR-1 and N-33 in colorectal mucosa of patients with ulcerative colitis (UC).
19717468 2009 Mammalian MagT1 and TUSC3 are required for cellular magnesium uptake and vertebrate embryonic development.
18455129 2008 Oligosaccharyltransferase-subunit mutations in nonsyndromic mental retardation.
18452889 2008 A defect in the TUSC3 gene is associated with autosomal recessive mental retardation.
17641416 2007 Deletions of N33, STK11 and TP53 are involved in the development of lymph node metastasis in larynx and pharynx carcinomas.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16270321 2005 Five genes from chromosomal band 8p22 are significantly down-regulated in ovarian carcinoma: N33 and EFA6R have a potential impact on overall survival.
15835887 2005 Proteomic analysis of mammalian oligosaccharyltransferase reveals multiple subcomplexes that contain Sec61, TRAP, and two potential new subunits.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12887896 2003 Oligosaccharyltransferase isoforms that contain different catalytic STT3 subunits have distinct enzymatic properties.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10097140 1999 The FEZ1 gene at chromosome 8p22 encodes a leucine-zipper protein, and its expression is altered in multiple human tumors.
9778121 1998 Differential display analysis of oxygen-mediated changes in gene expression in first trimester human trophoblast cells.
8661104 1996 Structure and methylation-associated silencing of a gene within a homozygously deleted region of human chromosome band 8p22.