Property Summary

NCBI Gene PubMed Count 22
PubMed Score 29.86
PubTator Score 15.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 5.5e-08
glioblastoma -1.100 1.7e-06
intraductal papillary-mucinous neoplasm ... -1.200 8.9e-03
medulloblastoma -1.100 1.2e-05
medulloblastoma, large-cell -1.500 3.3e-06
non primary Sjogren syndrome sicca 1.100 1.9e-02

Protein-protein Interaction (9)

Gene RIF (13)

AA Sequence

MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVT      1 - 70
KNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV                                   71 - 110
//

Text Mined References (24)

PMID Year Title