Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.83
PubTator Score 7.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.600 1.8e-02
oligodendroglioma -1.700 3.8e-02
intraductal papillary-mucinous adenoma (... -1.100 1.6e-03
subependymal giant cell astrocytoma -1.300 2.5e-03
ovarian cancer -1.800 2.7e-07

Gene RIF (5)

PMID Text
24700496 Results suggested that reduced expression of TUSC1 mRNA was related to poor prognosis and TUSC1 is a putative tumor suppressor gene that is suppressed through intragenic hypermethylation in gastric cancer.
24366000 TUSC1 is a candidate tumor suppressor gene and intragenic hypermethylation is one of the suppressive mechanisms that regulate TUSC1 transcription in hepatocellular carcinoma.
23776618 Results support TUSC1 has tumor suppressor activity as a candidate tumor suppressor gene located on chromosome 9p.
20574843 Observational study of gene-disease association. (HuGE Navigator)
15208665 TUSC1 may play a role in lung tumorigenesis

AA Sequence

MGPMWRMRGGATRRGSCCGGDGAADGRGPGRSGRARGGGSPSGGGGGVGWRGRADGARQQLEERFADLAA      1 - 70
SHLEAIRARDEWDRQNARLRQENARLRLENRRLKRENRSLFRQALRLPGEGGNGTPAEARRVPEEASTNR     71 - 140
RARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPSGP    141 - 210
WL                                                                        211 - 212
//

Text Mined References (16)

PMID Year Title
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24700496 2014 Clinical significance of expression and epigenetic profiling of TUSC1 in gastric cancer.
24366000 2014 Identification of intragenic methylation in the TUSC1 gene as a novel prognostic marker of hepatocellular carcinoma.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23776618 2013 TUSC1, a putative tumor suppressor gene, reduces tumor cell growth in vitro and tumor growth in vivo.
23728906 2013 A genome-wide association study of sleep habits and insomnia.
22633400 2012 Genome-wide association study identifies candidate genes for male fertility traits in humans.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21269460 2011 Initial characterization of the human central proteome.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20574843 2010 Associations of 9p21 variants with cutaneous malignant melanoma, nevi, and pigmentation phenotypes in melanoma-prone families with and without CDKN2A mutations.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15208665 2004 Identifying novel homozygous deletions by microsatellite analysis and characterization of tumor suppressor candidate 1 gene, TUSC1, on chromosome 9p in human lung cancer.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.