Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.29
PubTator Score 7.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.600 1.8e-02
intraductal papillary-mucinous adenoma (... -1.100 1.6e-03
oligodendroglioma -1.700 3.8e-02
ovarian cancer -1.800 2.7e-07
subependymal giant cell astrocytoma -1.300 2.5e-03

 Compartment GO Term (2)

Gene RIF (6)

AA Sequence

MGPMWRMRGGATRRGSCCGGDGAADGRGPGRSGRARGGGSPSGGGGGVGWRGRADGARQQLEERFADLAA      1 - 70
SHLEAIRARDEWDRQNARLRQENARLRLENRRLKRENRSLFRQALRLPGEGGNGTPAEARRVPEEASTNR     71 - 140
RARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPSGP    141 - 210
WL                                                                        211 - 212
//

Text Mined References (17)

PMID Year Title