Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.29
PubTator Score 1.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 6.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -1.800 6.9e-04

AA Sequence

MSQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANPDASPWLWRSCLREERLLGDR      1 - 70
GLGNPFLRKKVSEAHLPSGIHSALGTVSCGGDGRGERGLPTPRTEAVFRNLGLQSPFLSWLPDNSDAELE     71 - 140
EVSVENGSVSPPPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAF    141 - 210
QKEEDLEKKREASESTGTNSSAAHNEELSKALKGEGGTDSDHMRHEASLAIRSPCPGLEEDMEAYVLRPA    211 - 280
LPGTMMQCYLTRDKHGVDKGLFPLYYLYLETSDSLQRFLLAGRKRRRSKTSNYLISLDPTHLSRDGDNFV    281 - 350
GKVRSNVFSTKFTIFDNGVNPDREHLTRNTARIRQELGAVCYEPNVLGYLGPRKMTVILPGTNSQNQRIN    351 - 420
VQPLNEQESLLSRYQRGDKQGLLLLHNKTPSWDKENGVYTLNFHGRVTRASVKNFQIVDPKHQEHLVLQF    421 - 490
GRVGPDTFTMDFCFPFSPLQAFSICLSSFN                                            491 - 520
//

Text Mined References (9)

PMID Year Title