Property Summary

NCBI Gene PubMed Count 19
PubMed Score 68.20
PubTator Score 6.42

Knowledge Summary


No data available


  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma -1.794 1.9e-02

Gene RIF (2)

25817018 Mutations in TUBGCP4 alter microtubule organization via the gamma-tubulin ring complex in autosomal-recessive microcephaly with chorioretinopathy.
20508983 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

SSVRNHQINSDLAQLLLRLDYNKYYTQAGGTLGSFGM                                     631 - 667

Text Mined References (22)

PMID Year Title
26213385 2015 ATF5 Connects the Pericentriolar Materials to the Proximal End of the Mother Centriole.
25817018 2015 Mutations in TUBGCP4 alter microtubule organization via the ?-tubulin ring complex in autosomal-recessive microcephaly with chorioretinopathy.
25416956 2014 A proteome-scale map of the human interactome network.
24561039 2014 Rab11 endosomes contribute to mitotic spindle organization and orientation.
21725292 2011 Crystal structure of ?-tubulin complex protein GCP4 provides insight into microtubule nucleation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
19946888 2010 Defining the membrane proteome of NK cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11956313 2002 Direct binding of NuMA to tubulin is mediated by a novel sequence motif in the tail domain that bundles and stabilizes microtubules.
11694571 2001 GCP5 and GCP6: two new members of the human gamma-tubulin complex.
10562286 1999 Human 76p: A new member of the gamma-tubulin-associated protein family.
8838651 1996 Dynamic changes of NuMA during the cell cycle and possible appearance of a truncated form of NuMA during apoptosis.