Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.37
PubTator Score 2.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.173 2.4e-03
ependymoma -1.800 6.2e-12
glioblastoma -2.200 1.4e-05
sonic hedgehog group medulloblastoma -2.400 2.6e-07
atypical teratoid / rhabdoid tumor -2.000 1.0e-08
medulloblastoma, large-cell -3.200 1.3e-06
primitive neuroectodermal tumor -1.400 1.5e-04
interstitial cystitis -1.400 8.6e-05
pediatric high grade glioma -2.100 1.7e-07
pilocytic astrocytoma -1.300 1.1e-06
subependymal giant cell astrocytoma -1.429 1.4e-02
Pick disease -1.500 5.6e-06

 MGI Phenotype (1)

Gene RIF (7)

PMID Text
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
22806905 Our results reveal for the first time an increased expression of TUBG1 and TUBG2 in lung cancer
22235350 gamma-tubulin 2 is able to nucleate microtubules and substitute for gamma-tubulin 1
20508983 Observational study of gene-disease association. (HuGE Navigator)
15698476 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15691386 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
14767062 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type

AA Sequence

MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLE      1 - 70
PRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHS     71 - 140
IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTAL    141 - 210
NRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ    211 - 280
SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIP    281 - 350
WGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDE    351 - 420
MDRSREVVQELIDEYHAATQPDYISWGTQEQ                                           421 - 451
//

Text Mined References (17)

PMID Year Title
27015882 2016 Human TUBG2 gene is expressed as two splice variant mRNA and involved in cell growth.
22806905 2012 Overexpression of ?-tubulin in non-small cell lung cancer.
22235350 2012 ?-Tubulin 2 nucleates microtubules and is downregulated in mouse early embryogenesis.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11956313 2002 Direct binding of NuMA to tubulin is mediated by a novel sequence motif in the tail domain that bundles and stabilizes microtubules.
11237715 2001 A novel centrosomal ring-finger protein, dorfin, mediates ubiquitin ligase activity.
10903841 2000 The gamma-tubulin gene family in humans.
10840040 2000 Paxillin localizes to the lymphocyte microtubule organizing center and associates with the microtubule cytoskeleton.
9566969 1998 Characterization of the human homologue of the yeast spc98p and its association with gamma-tubulin.
8838651 1996 Dynamic changes of NuMA during the cell cycle and possible appearance of a truncated form of NuMA during apoptosis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.