Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.79
PubTator Score 4.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Lissencephaly 61 4.165 2.1
Microcephaly 149 3.955 2.0
Nail disease 9 3.379 1.7

Expression

 GO Process (1)

Protein-protein Interaction (6)

Gene RIF (10)

PMID Text
24275654 Data indicate that leucine-rich repeat kinase 2 (LRRK2) selectively interacts with three beta-tubulin isoforms: TUBB, TUBB4, and TUBB6.
24173717 TUBB6 is an inhibitor of pyroptosis.
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
22903939 betaV-tubulin expression is a potentially promising prognostic marker of malignancy.
22438565 in colorectal cancer patients, there was a link between poor survival, the expression of TUBB3/TUBB6, and androgen receptor only in females
20191564 The TUBB6 expression was largely decreased in most tumors.
16526095 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15331610 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
12486001 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
10908577 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type

AA Sequence

MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQLERINVYYNESSSQKYVPRAALVDLEP      1 - 70
GTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGHYTEGAELVDAVLDVVRKECEHCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEFPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDARNMMAACDPRHGRYLTVATVFRGPMSMKEVDEQMLAIQSKNSSYFVEWIPNNVK    281 - 350
VAVCDIPPRGLKMASTFIGNSTAIQELFKRISEQFSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATANDGEEAFEDEEEEIDG                                                421 - 446
//

Text Mined References (23)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
24275654 2014 A direct interaction between leucine-rich repeat kinase 2 and specific ?-tubulin isoforms regulates tubulin acetylation.
24173717 2014 A cellular genome-wide association study reveals human variation in microtubule stability and a role in inflammatory cell death.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22903939 2012 Characterization of a human ?V-tubulin antibody and expression of this isotype in normal and malignant human tissue.
22438565 2012 Gender influences the class III and V ?-tubulin ability to predict poor outcome in colorectal cancer.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20191564 2010 Tumoral and tissue-specific expression of the major human beta-tubulin isotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19524510 2009 Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18613117 2008 Beta-tubulin isotype classes II and V expression patterns in nonsmall cell lung carcinomas.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16371510 2006 Microtubule regulation in mitosis: tubulin phosphorylation by the cyclin-dependent kinase Cdk1.
16313188 2005 Detection of human betaV-tubulin expression in epithelial cancer cell lines by tubulin proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
84617 1978 Amino-proximal sequences of the argF and argI ornithine carbamoyltransferases from Escherichia coli K-12 [proceedings].