Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.79
PubTator Score 4.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Duchenne muscular dystrophy 602 6.75994839812174E-11
posterior fossa group A ependymoma 1511 2.59412616246555E-10
juvenile dermatomyositis 1189 9.50071914406285E-9
ulcerative colitis 2087 2.25803952947092E-7
intraductal papillary-mucinous adenoma (IPMA) 2956 1.57122871099271E-6
lung cancer 4473 2.58959252368425E-6
ovarian cancer 8492 4.65873524352297E-6
lung adenocarcinoma 2714 4.86903289704326E-6
pituitary cancer 1972 5.18746705185608E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.67521856719808E-6
Breast cancer 3099 4.96380435846249E-5
pediatric high grade glioma 2712 5.69374839298981E-5
atypical teratoid / rhabdoid tumor 4369 7.12938405226389E-5
limb girdle muscular dystrophy 2B 74 8.62756637358614E-5
psoriasis 6685 1.0368862883213E-4
interstitial cystitis 2299 2.36775755026771E-4
breast carcinoma 1614 8.54024063632109E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.65337357983348E-4
Becker muscular dystrophy 187 8.89116208903771E-4
acute quadriplegic myopathy 1157 0.00114395215976707
chronic lymphocytic leukemia 244 0.00215881757712548
invasive ductal carcinoma 2950 0.00277753244646723
primary pancreatic ductal adenocarcinoma 1271 0.00304061114655383
pancreatic cancer 2300 0.00430881750187495
adrenocortical adenoma 134 0.00464375421059432
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00544217356496043
sonic hedgehog group medulloblastoma 1482 0.0055623903132433
primitive neuroectodermal tumor 3031 0.0147414897235953
gastric carcinoma 832 0.0172797127532195
colon cancer 1475 0.0172853489948982
esophageal adenocarcinoma 737 0.0179350527878244
fibroadenoma 557 0.0202332066874371
tuberculosis 1563 0.0218929521271974
glioblastoma 5572 0.0234210641177526
Disease Target Count Z-score Confidence
Lissencephaly 61 4.165 2.1
Microcephaly 149 3.955 2.0
Nail disease 9 3.379 1.7

Expression

Synonym

Accession Q9BUF5 B3KM76 Q9HA42
Symbols TUBB-5
HsT1601

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
S.cerevisiae OMA EggNOG

 GO Process (1)

Gene RIF (10)

PMID Text
24275654 Data indicate that leucine-rich repeat kinase 2 (LRRK2) selectively interacts with three beta-tubulin isoforms: TUBB, TUBB4, and TUBB6.
24173717 TUBB6 is an inhibitor of pyroptosis.
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
22903939 betaV-tubulin expression is a potentially promising prognostic marker of malignancy.
22438565 in colorectal cancer patients, there was a link between poor survival, the expression of TUBB3/TUBB6, and androgen receptor only in females
20191564 The TUBB6 expression was largely decreased in most tumors.
16526095 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15331610 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
12486001 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
10908577 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type

AA Sequence

MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQLERINVYYNESSSQKYVPRAALVDLEP      1 - 70
GTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGHYTEGAELVDAVLDVVRKECEHCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEFPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDARNMMAACDPRHGRYLTVATVFRGPMSMKEVDEQMLAIQSKNSSYFVEWIPNNVK    281 - 350
VAVCDIPPRGLKMASTFIGNSTAIQELFKRISEQFSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATANDGEEAFEDEEEEIDG                                                421 - 446
//

Text Mined References (23)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
24275654 2014 A direct interaction between leucine-rich repeat kinase 2 and specific ?-tubulin isoforms regulates tubulin acetylation.
24173717 2014 A cellular genome-wide association study reveals human variation in microtubule stability and a role in inflammatory cell death.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22903939 2012 Characterization of a human ?V-tubulin antibody and expression of this isotype in normal and malignant human tissue.
22438565 2012 Gender influences the class III and V ?-tubulin ability to predict poor outcome in colorectal cancer.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...