Property Summary

NCBI Gene PubMed Count 34
PubMed Score 16.70
PubTator Score 13.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer 1.100 2.6e-02
hepatocellular carcinoma 1.100 3.4e-02
pancreatic cancer 1.600 5.9e-03
osteosarcoma -4.227 1.2e-03
chronic lymphosyte leukemia -1.100 4.3e-05
non-small cell lung cancer -1.208 1.7e-11
pancreatic carcinoma 1.600 5.9e-03
mucosa-associated lymphoid tissue lympho... 2.191 2.4e-02

Protein-protein Interaction (11)

Gene RIF (28)

PMID Text
26637975 Mutations in either TUBB or MAPRE2 cause circumferential skin creases Kunze type.
25529050 TUBB1 R307H SNP is significantly associated with the degree of thrombocytopenia in congenital and acquired platelet disorders, and may affect platelets by altering microtubule behavior.
24894670 Data indicate that ABCB1 protein, beta tubulin I and III (betaI, and betaIII tubulin) might contribute to the multidrug resistance (MDR) of MCF7/DOC and be potential therapeutic targets for overcoming MDR of breast cancer.
24344610 TUBB1 mutation disrupting microtubule assembly impairs proplatelet formation and results in congenital macrothrombocytopenia.
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
22805305 our findings define beta-tubulin VI as a hematologic isotype with significant genetic variation in humans that may affect the myelosuppresive action of microtubule-binding drugs
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21384078 homozygous status of P43 genetic polymorphism causes alterations in platelet ultrastructure
20532885 Observational study of gene-disease association. (HuGE Navigator)
20103599 human tumor cells can acquire spontaneous mutations in beta1-tubulin that cause resistance to paclitaxel
19996274 Studies show that BFBTS bound and modified beta-tubulin at residue Cys12, forming beta-tubulin-SS-fluorobenzyl.
19388931 Observational study of gene-disease association. (HuGE Navigator)
19132255 TUBB1 Q43P polymorphism does not protect against acute coronary syndrome and premature myocardial infarction.
19132255 Observational study of gene-disease association. (HuGE Navigator)
19074767 Roles of tubulin beta 1,3 residues Ala428 and Thr429 in microtubule formation in vivo.
18849486 Mutation of the beta1-tubulin gene associated with congenital macrothrombocytopenia affecting microtubule assembly.
17993481 biophysical analysis of carboxy-terminal tail conformation of human beta-tubulin isotypes
17488662 The TUBB1 Q43P polymorphism, by causing a lower reactivity in platelets carrying the variant form of b1-tubulin, protects against thrombotic disorders but increases the risk of intracerebral hemorrhage in men.
16526095 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
16095531 TUBB exon 4 mutations and mismatch repair defects do not play a significant role in paclitaxel/cisplatin resistance
15956286 Observational study of gene-disease association. (HuGE Navigator)
15956286 the platelet Q43P beta1-tubulin substitution is frequent in the healthy population and may protect men against arterial thrombosis
15698476 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15691386 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15331610 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15315966 SLPI localizes in part along the megakaaryocyte and platelet cytoskeleton by virtue of specific interactions with beta1 tubulin.
12486001 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
10908577 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type

AA Sequence

MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEP      1 - 70
GTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLG     71 - 140
GGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQ    211 - 280
YRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVK    281 - 350
VAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVS    351 - 420
EYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH                                           421 - 451
//

Text Mined References (38)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
26637975 2015 Mutations in Either TUBB or MAPRE2 Cause Circumferential Skin Creases Kunze Type.
25529050 2015 ?-1 tubulin R307H SNP alters microtubule dynamics and affects severity of a hereditary thrombocytopenia.
24894670 2014 Association of ABCB1, ? tubulin I, and III with multidrug resistance of MCF7/DOC subline from breast cancer cell line MCF7.
24344610 2014 TUBB1 mutation disrupting microtubule assembly impairs proplatelet formation and results in congenital macrothrombocytopenia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22805305 2012 Hematologic ?-tubulin VI isoform exhibits genetic variability that influences paclitaxel toxicity.
22423221 2012 A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21384078 2011 Rare homozygous status of P43 ?1-tubulin polymorphism causes alterations in platelet ultrastructure.
21309084 2011 Megakaryocyte lineage-specific class VI ?-tubulin suppresses microtubule dynamics, fragments microtubules, and blocks cell division.
20532885 2010 Study of 18 functional hemostatic polymorphisms in mucocutaneous bleeding disorders.
20191564 2010 Tumoral and tissue-specific expression of the major human beta-tubulin isotypes.
20103599 2010 Human mutations that confer paclitaxel resistance.
19996274 2009 Natural product derivative Bis(4-fluorobenzyl)trisulfide inhibits tumor growth by modification of beta-tubulin at Cys 12 and suppression of microtubule dynamics.
19524510 2009 Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation.
19388931 2009 Genotype-phenotype relationship for six common polymorphisms in genes affecting platelet function from 286 healthy subjects and 160 patients with mucocutaneous bleeding of unknown cause.
19132255 2008 TUBB1 Q43P polymorphism does not protect against acute coronary syndrome and premature myocardial infarction.
19074767 2009 Roles of beta-tubulin residues Ala428 and Thr429 in microtubule formation in vivo.
18849486 2009 Mutation of the beta1-tubulin gene associated with congenital macrothrombocytopenia affecting microtubule assembly.
18347012 2008 RanBP10 is a cytoplasmic guanine nucleotide exchange factor that modulates noncentrosomal microtubules.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17993481 2008 Conformational analysis of the carboxy-terminal tails of human beta-tubulin isotypes.
17488662 2007 The association of the beta1-tubulin Q43P polymorphism with intracerebral hemorrhage in men.
16371510 2006 Microtubule regulation in mitosis: tubulin phosphorylation by the cyclin-dependent kinase Cdk1.
16095531 2005 No significant role for beta tubulin mutations and mismatch repair defects in ovarian cancer resistance to paclitaxel/cisplatin.
15956286 2005 The TUBB1 Q43P functional polymorphism reduces the risk of cardiovascular disease in men by modulating platelet function and structure.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15315966 2004 Interactions between the megakaryocyte/platelet-specific beta1 tubulin and the secretory leukocyte protease inhibitor SLPI suggest a role for regulated proteolysis in platelet functions.
15304323 2004 TTK kinase is essential for the centrosomal localization of TACC2.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12486001 2002 HIV-1 Tat targets microtubules to induce apoptosis, a process promoted by the pro-apoptotic Bcl-2 relative Bim.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10908577 2000 HIV-1 rev depolymerizes microtubules to form stable bilayered rings.
3782288 1986 The mammalian beta-tubulin repertoire: hematopoietic expression of a novel, heterologous beta-tubulin isotype.