Property Summary

NCBI Gene PubMed Count 73
PubMed Score 84.48
PubTator Score 63.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Lissencephaly 61 3.068 1.5

Expression

  Differential Expression (17)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2205 screening 1625 / 0 / 194228 HCS assay for microtubule stabilizers

Gene RIF (33)

PMID Text
26165356 Data show that tubulin phosphorylation and acetylation play important roles in the control of microtubule assembly and stability.
26081685 Data suggest a looser binding of the ligand in tubulin mutants.
26016807 Data suggest that, while lacking a stable structure, NFL-TBS.40-63 peptide (a peptide derived from light neurofilament protein) preferentially binds on a specific single site located near C-terminal end of beta-tubulin.
24275654 Data indicate that leucine-rich repeat kinase 2 (LRRK2) selectively interacts with three beta-tubulin isoforms: TUBB, TUBB4, and TUBB6.
24161989 mechanism of binding and stabilization of microtubules in mammalian cells can be effectively modeled in yeast and also having the advantage of lacking any beta-tubulin isotypes that can complicate interpretation of experiments in mammalian cells.
24099319 Citrullination of TUBB is associated with neoplasms.
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
23818224 Studies suggest that tubulin-interactive agents have the potential to play a significant role in the fight against cancer.
23285209 Centaurin-alpha interacts with beta-tubulin and stabilizes microtubules.
23246003 results provide insight into the functional repertoire of the tubulin gene family, specifically implicating TUBB5 in embryonic neurogenesis and microcephaly
23157319 Allele frequencies between a group of 191 ITP patients & controls showed no direct aetiological role for SNP (R307H), but it was associated with immunomodulatory treatment failure.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22174317 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
21881916 TQ induced a concentration- and time-dependent degradation of alpha/beta tubulin in both cancer cell types.
21653684 This is the first cell-based evidence to support a beta-tubulin-binding site for peloruside A and laulimalide.
21327297 Data show that knockdown of S100P led to downregulation of thioredoxin 1 and beta-tubulin and upregulation of RhoGDIA, all potential therapeutic targets in cancer.
20677014 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19405953 This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia.
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
17869412 Results suggest that glutamate198 in beta-tubulin is a critical determinant for microtubule stability and Taxol resistance.
17569113 Nuclear matrix proteins such as mutant Pyst1 and nucleophosmin 1 were downregulated, whereas eIF6 and beta-tubulin were upregulated during cell differentiation in hepatocarcinoma cells.
17488662 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17389232 Given that Spastin engages the MT in two places, we propose that severing occurs by forces exerted on the C-terminal tail of tubulin, which results in a conformational change in tubulin, which releases it from the polymer.
17360745 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
16941085 the dipole moments of each tubulin isotype may influence their functional characteristics within the cell, resulting in differences for MT assembly kinetics and stability
16526095 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
16380805 cDNA subtraction revealed increased expression of alpha3-tubulin in the taxol-resistant cell line.
16371510 These data indicate that phosphorylation of tubulin by Cdk1 could be involved in the regulation of microtubule dynamics during mitosis.
15003198 Review of studies comparing beta-tubulin mutations with antitubulin drug resistance. Throws doubts on earlier such correlation because of the existence of many pseudogenes for beta-tubulin.
12893435 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12826311 the influence of beta-tubulin mutations in paclitaxel resistance in advanced non-small cell lung cancer
12209587 Mutational analysis of the class I beta-tubulin gene in human breast cancer

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATAEEEEDFGEEAEEEA                                                  421 - 444
//

Text Mined References (82)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
26637975 2015 Mutations in Either TUBB or MAPRE2 Cause Circumferential Skin Creases Kunze Type.
26165356 2015 Proteomic Profiling and Functional Characterization of Multiple Post-Translational Modifications of Tubulin.
26081685 2015 Structural basis for drug resistance conferred by ?-tubulin mutations: a molecular modeling study on native and mutated tubulin complexes with epothilone B.
26016807 2015 Investigating the Structural Variability and Binding Modes of the Glioma Targeting NFL-TBS.40-63 Peptide on Tubulin.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24375412 2014 Programmed cell death protein 5 interacts with the cytosolic chaperonin containing tailless complex polypeptide 1 (CCT) to regulate ?-tubulin folding.
24275654 2014 A direct interaction between leucine-rich repeat kinase 2 and specific ?-tubulin isoforms regulates tubulin acetylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24161989 2014 Characterizing the laulimalide-peloruside binding site using site-directed mutagenesis of TUB2 in S. cerevisiae.
24099319 2013 Investigating citrullinated proteins in tumour cell lines.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23818224 2013 Tubulin-interactive stilbene derivatives as anticancer agents.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23325789 2013 cAMP-stimulated phosphorylation of diaphanous 1 regulates protein stability and interaction with binding partners in adrenocortical cells.
23285209 2012 Centaurin-?? interacts with ?-tubulin and stabilizes microtubules.
23246003 2012 Mutations in the ?-tubulin gene TUBB5 cause microcephaly with structural brain abnormalities.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23157319 2013 The beta 1 tubulin R307H single nucleotide polymorphism is associated with treatment failures in immune thrombocytopenia (ITP).
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21881916 2012 Anti-neoplastic agent thymoquinone induces degradation of ? and ? tubulin proteins in human cancer cells without affecting their level in normal human fibroblasts.
21753002 2011 Parkin interacts with Ambra1 to induce mitophagy.
21653684 2011 Peloruside- and laulimalide-resistant human ovarian carcinoma cells have ?I-tubulin mutations and altered expression of ?II- and ?III-tubulin isotypes.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21327297 2011 Targeting S100P inhibits colon cancer growth and metastasis by Lentivirus-mediated RNA interference and proteomic analysis.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20643351 2010 Pitchfork regulates primary cilia disassembly and left-right asymmetry.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20191564 2010 Tumoral and tissue-specific expression of the major human beta-tubulin isotypes.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19628478 2009 Mutant huntingtin interacts with {beta}-tubulin and disrupts vesicular transport and insulin secretion.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19524510 2009 Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation.
19405953 2009 Proteome analysis of schizophrenia patients Wernicke's area reveals an energy metabolism dysregulation.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
18457437 2008 Identification of intracellular proteins associated with the EBV-encoded nuclear antigen 5 using an efficient TAP procedure and FT-ICR mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17869412 2007 Wild-type class I beta-tubulin sensitizes Taxol-resistant breast adenocarcinoma cells harboring a beta-tubulin mutation.
17569113 2007 Alteration of nuclear matrix-intermediate filament system and differential expression of nuclear matrix proteins during human hepatocarcinoma cell differentiation.
17488662 2007 The association of the beta1-tubulin Q43P polymorphism with intracerebral hemorrhage in men.
17389232 2007 Recognition of C-terminal amino acids in tubulin by pore loops in Spastin is important for microtubule severing.
16941085 2006 Homology modeling of tubulin: influence predictions for microtubule's biophysical properties.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16380805 2006 Differential gene expression in a paclitaxel-resistant clone of a head and neck cancer cell line.
16371510 2006 Microtubule regulation in mitosis: tubulin phosphorylation by the cyclin-dependent kinase Cdk1.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15959508 2005 Nucleotide-dependent bending flexibility of tubulin regulates microtubule assembly.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
15120663 2004 Do beta-tubulin pseudogenes really matter?
15014504 2004 Insight into tubulin regulation from a complex with colchicine and a stathmin-like domain.
15003198 2004 Do beta-tubulin mutations have a role in resistance to chemotherapy?
12893435 2003 Mutation of the class I beta-tubulin gene does not predict response to paclitaxel for breast cancer.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12826311 2003 New insights in beta-tubulin sequence analysis in non-small cell lung cancer.
12519789 2003 Proteomic and biochemical analyses of human B cell-derived exosomes. Potential implications for their function and multivesicular body formation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12209587 2002 Mutational analysis of the class I beta-tubulin gene in human breast cancer.
11750707 2002 Mutational analysis of the beta-tubulin gene in lung cancer.
11504633 2001 Tubulins in the primate retina: evidence that xanthophylls may be endogenous ligands for the paclitaxel-binding site.
11120798 2000 HLA-B2702 (77-83/83-77) peptide binds to beta-tubulin on human NK cells and blocks their cytotoxic capacity.
10561216 1999 Paclitaxel resistance in non-small-cell lung cancer associated with beta-tubulin gene mutations.
9110174 1997 Large-scale concatenation cDNA sequencing.
8895530 1996 A pancreatic cancer-specific expression profile.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8270253 1994 Presence of an expressed beta-tubulin gene (TUBB) in the HLA class I region may provide the genetic basis for HLA-linked microtubule dysfunction.
6946435 1981 Structural variation among human beta-tubulin genes.
6893015 1980 Number and evolutionary conservation of alpha- and beta-tubulin and cytoplasmic beta- and gamma-actin genes using specific cloned cDNA probes.
6865944 1983 Identification of two human beta-tubulin isotypes.
6688039 1983 Evolutionary history of a multigene family: an expressed human beta-tubulin gene and three processed pseudogenes.
3782288 1986 The mammalian beta-tubulin repertoire: hematopoietic expression of a novel, heterologous beta-tubulin isotype.
3405308 1988 Autoregulated instability of beta-tubulin mRNAs by recognition of the nascent amino terminus of beta-tubulin.
3007184 1986 An expressed beta-tubulin gene, TUBB, is located on the short arm of human chromosome 6 and two related sequences are dispersed on chromosomes 8 and 13.