Property Summary

NCBI Gene PubMed Count 84
PubMed Score 29.57
PubTator Score 28.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (25)

Gene RIF (28)

PMID Text
26465396 In conclusion, our current results did not find an association between TUBA4A and ALS in Chinese patients, and further studies will be required.
26103986 Data show that overexpression of the 14-3-3sigma isoform resulted in a disruption of the tubulin cytoskeleton mediated by binding Tau protein.
25893256 This study mutational screening revealed the presence of four novel heterozygous variants of TUBA4A mutation in four sporadic amyotrophic lateral sclerosis.
25374358 TUBA4A mutants destabilize the microtubule network, diminishing its repolymerization capability
24268707 TUBA4A is significantly increased in spermatazoa from men with azoospermia.
23826228 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22174317 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21167302 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20686780 The results suggested that cytoskeletal alterations in the amygdala determined by tubulin seem to be involved in the pathophysiology of drug addiction
20668689 Subunits of alphaB crystallin that exchange dynamically with the alphaB crystallin complex can interact with tubulin subunits to regulate the equilibrium between tubulin and microtubules.
20546612 Observational study of gene-disease association. (HuGE Navigator)
18613978 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
18400243 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
17360745 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
16327313 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
16257120 These results provide the first characterisation of endogenously nitrated tubulin from human tumour samples.
16148047 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
16039987 Our results suggest that MIZIP might play an important role in mammalian cells by associating with tubulin and thus might provide a link between MCHR1 and tubulin functions.
15934946 Some protein-protein interactions in rafts were disrupted in 3-nitrotyrosine-containing proteins, e.g. caveolin-1 was dissociated from a complex with flotillin-1 and alpha-tubulin.
15698476 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
15691386 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
15331610 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
15103018 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12486001 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12054644 increased levels in paclitaxel-resistant breast cancer cells
10908577 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDL      1 - 70
EPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHS     71 - 140
FGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY    141 - 210
DICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK    211 - 280
AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTG    281 - 350
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE    351 - 420
AREDMAALEKDYEEVGIDSYEDEDEGEE                                              421 - 448
//

Text Mined References (95)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
26465396 2015 TUBA4A may not be a significant genetic factor in Chinese ALS patients.
26103986 2015 Involvement of 14-3-3 in tubulin instability and impaired axon development is mediated by Tau.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25893256 2015 TUBA4A gene analysis in sporadic amyotrophic lateral sclerosis: identification of novel mutations.
25374358 2014 Exome-wide rare variant analysis identifies TUBA4A mutations associated with familial ALS.
24906155 2014 Molecular basis for age-dependent microtubule acetylation by tubulin acetyltransferase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24268707 2014 Acetylated ?-tubulin is reduced in individuals with poor sperm motility.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21269460 2011 Initial characterization of the human central proteome.
20686780 2011 Postmortem proteomic analysis in human amygdala of drug addicts: possible impact of tubulin on drug-abusing behavior.
20668689 2010 Dynamic subunit exchange and the regulation of microtubule assembly by the stress response protein human alphaB crystallin.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19524510 2009 Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16455083 2006 Microtubule binding proteins CLIP-170, EB1, and p150Glued form distinct plus-end complexes.
16257120 2006 Tubulin nitration in human gliomas.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16039987 2005 MYND domain specific interaction of the melanin-concentrating hormone receptor 1 interacting zinc-finger protein with alpha- and beta-tubulin.
15934946 2005 Protein tyrosine nitration in rat brain is associated with raft proteins, flotillin-1 and alpha-tubulin: effect of biological aging.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15659558 2005 Phosphotyrosine proteomic study of interferon alpha signaling pathway using a combination of immunoprecipitation and immobilized metal affinity chromatography.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15184364 2004 Protein 4.1R, a microtubule-associated protein involved in microtubule aster assembly in mammalian mitotic extract.
15129282 2004 Functional variation in LGALS2 confers risk of myocardial infarction and regulates lymphotoxin-alpha secretion in vitro.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697242 2004 Chromosome 13q12 encoded Rho GTPase activating protein suppresses growth of breast carcinoma cells, and yeast two-hybrid screen shows its interaction with several proteins.
14634002 2004 Selective contribution of eukaryotic prefoldin subunits to actin and tubulin binding.
14630798 2004 Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.
14594945 2004 MARK4 is a novel microtubule-associated proteins/microtubule affinity-regulating kinase that binds to the cellular microtubule network and to centrosomes.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12749852 2003 Identification of alpha-tubulin as an hsp105alpha-binding protein by the yeast two-hybrid system.
12716939 2003 Parkin binds to alpha/beta tubulin and increases their ubiquitination and degradation.
12639963 2003 The prostate-derived sterile 20-like kinase (PSK) regulates microtubule organization and stability.
12639940 2003 Rab8B GTPase and junction dynamics in the testis.
12620231 2003 The human Sir2 ortholog, SIRT2, is an NAD+-dependent tubulin deacetylase.
12486001 2002 HIV-1 Tat targets microtubules to induce apoptosis, a process promoted by the pro-apoptotic Bcl-2 relative Bim.
12482968 2003 Activating signal cointegrator 2 belongs to a novel steady-state complex that contains a subset of trithorax group proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12377379 2002 Nogo-A expression in mature oligodendrocytes of rat spinal cord in association with specific molecules.
12353262 2002 Subcellular localization of the BRCA1 gene product in mitotic cells.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
12134159 2002 CRMP-2 binds to tubulin heterodimers to promote microtubule assembly.
12087096 2002 Tubulin is an inherent component of mitochondrial membranes that interacts with the voltage-dependent anion channel.
12054644 2002 Increased levels of tyrosinated alpha-, beta(III)-, and beta(IV)-tubulin isotypes in paclitaxel-resistant MCF-7 breast cancer cells.
12052837 2002 Structural requirements for the recruitment of Gaa1 into a functional glycosylphosphatidylinositol transamidase complex.
12024216 2002 HDAC6 is a microtubule-associated deacetylase.
11964161 2002 Identification of Ca2+-dependent binding partners for the neuronal calcium sensor protein neurocalcin delta: interaction with actin, clathrin and tubulin.
11953448 2002 Interaction between metabotropic glutamate receptor 7 and alpha tubulin.
11942621 2001 Role of MgcRacGAP/Cyk4 as a regulator of the small GTPase Rho family in cytokinesis and cell differentiation.
11563969 2001 Chloride intracellular channel protein CLIC4 (p64H1) binds directly to brain dynamin I in a complex containing actin, tubulin and 14-3-3 isoforms.
11278895 2001 Differential binding regulation of microtubule-associated proteins MAP1A, MAP1B, and MAP2 by tubulin polyglutamylation.
11163133 2001 The tubulin fraternity: alpha to eta.
11146551 2000 SIAH-1 interacts with alpha-tubulin and degrades the kinesin Kid by the proteasome pathway during mitosis.
11121746 2000 An abundance of tubulins.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
10942575 2000 Association between the calcium-binding protein calretinin and cytoskeletal components in the human colon adenocarcinoma cell line WiDr.
10908577 2000 HIV-1 rev depolymerizes microtubules to form stable bilayered rings.
10191277 1999 Association of polo-like kinase with alpha-, beta- and gamma-tubulins in a stable complex.
10037711 1999 Identification of a domain in guanylyl cyclase-activating protein 1 that interacts with a complex of guanylyl cyclase and tubulin in photoreceptors.
9922135 1998 The microtubule-associated protein tau cross-links to two distinct sites on each alpha and beta tubulin monomer via separate domains.
9885248 1999 Alf1p, a CLIP-170 domain-containing protein, is functionally and physically associated with alpha-tubulin.
9722999 1998 Tubulin and FtsZ structures: functional and therapeutic implications.
9593747 1998 Characterization of the microtubule-binding domain of microtubule-associated protein 1A and its effects on microtubule dynamics.
9265649 1997 Tubulin subunits exist in an activated conformational state generated and maintained by protein cofactors.
8856662 1996 Functionally distinct isoforms of dynactin are expressed in human neurons.
8631991 1996 The Ras-related GTPase Rac1 binds tubulin.
8617742 1996 Syk, activated by cross-linking the B-cell antigen receptor, localizes to the cytosol where it interacts with and phosphorylates alpha-tubulin on tyrosine.
8566014 1995 Human T lymphocyte activation induces tyrosine phosphorylation of alpha-tubulin and its association with the SH2 domain of the p59fyn protein tyrosine kinase.
8530437 1995 Interactions between the protein-tyrosine kinase ZAP-70, the proto-oncoprotein Vav, and tubulin in Jurkat T cells.
8325901 1993 Characterization of a 50-kDa polypeptide in cytoplasmic dynein preparations reveals a complex with p150GLUED and a novel actin.
8294455 1994 In vitro analysis of microtubule assembly of isotypically pure tubulin dimers. Intrinsic differences in the assembly properties of alpha beta II, alpha beta III, and alpha beta IV tubulin dimers in the absence of microtubule-associated proteins.
7878030 1995 The p150Glued component of the dynactin complex binds to both microtubules and the actin-related protein centractin (Arp-1).
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.
7744867 1995 Golgi retention mechanism of beta-1,4-galactosyltransferase. Membrane-spanning domain-dependent homodimerization and association with alpha- and beta-tubulins.
7651436 1995 The N-terminal domain of c-Myc associates with alpha-tubulin and microtubules in vivo and in vitro.
6457647 1981 Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.
3839072 1985 Structural features and restricted expression of a human alpha-tubulin gene.
3785200 1986 Six mouse alpha-tubulin mRNAs encode five distinct isotypes: testis-specific expression of two sister genes.
3029670 1987 Alternative 5' exons either provide or deny an initiator methionine codon to the same alpha-tubulin coding region.
1657993 1991 The 93-kDa glycine receptor-associated protein binds to tubulin.