Property Summary

NCBI Gene PubMed Count 28
PubMed Score 5.25
PubTator Score 7.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Condyloma acuminatum 7
Disease Target Count P-value
breast carcinoma 1614 2.7e-04
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Clouston syndrome 9 5.553 2.8
Kabuki syndrome 29 3.155 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.400 2.7e-04

Protein-protein Interaction (7)

Gene RIF (13)

PMID Text
24268707 TUBA3C (and TUBA4A) are differentially expressed in individuals with poor sperm motility.
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
21167302 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
18400243 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
17360745 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
16327313 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
16148047 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15698476 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15691386 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15331610 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15103018 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
12486001 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
10908577 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type

AA Sequence

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL      1 - 70
EPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHS     71 - 140
FGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY    141 - 210
DICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK    211 - 280
AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG    281 - 350
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE    351 - 420
AREDLAALEKDYEEVGVDSVEAEAEEGEEY                                            421 - 450
//

Text Mined References (33)

PMID Year Title
26972003 2016 ?-Tubulin Tyrosination and CLIP-170 Phosphorylation Regulate the Initiation of Dynein-Driven Transport in Neurons.
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
25908662 2015 Mitosis. Microtubule detyrosination guides chromosomes during mitosis.
24906155 2014 Molecular basis for age-dependent microtubule acetylation by tubulin acetyltransferase.
24268707 2014 Acetylated ?-tubulin is reduced in individuals with poor sperm motility.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
21630459 2011 Proteomic characterization of the human sperm nucleus.
19524510 2009 Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
12486001 2002 HIV-1 Tat targets microtubules to induce apoptosis, a process promoted by the pro-apoptotic Bcl-2 relative Bim.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11953448 2002 Interaction between metabotropic glutamate receptor 7 and alpha tubulin.
11826099 2002 Process outgrowth of oligodendrocytes is promoted by interaction of fyn kinase with the cytoskeletal protein tau.
11535601 2001 Prefoldin recognition motifs in the nonhomologous proteins of the actin and tubulin families.
11278332 2001 Binding of heterochromatin protein 1 to the nuclear envelope is regulated by a soluble form of tubulin.
11163133 2001 The tubulin fraternity: alpha to eta.
11146551 2000 SIAH-1 interacts with alpha-tubulin and degrades the kinesin Kid by the proteasome pathway during mitosis.
11121746 2000 An abundance of tubulins.
11082048 2000 Identification of an alpha-tubulin mutant of fission yeast from gamma-tubulin-interacting protein screening: genetic evidence for alpha-/gamma-tubulin interaction.
10908577 2000 HIV-1 rev depolymerizes microtubules to form stable bilayered rings.
10840040 2000 Paxillin localizes to the lymphocyte microtubule organizing center and associates with the microtubule cytoskeleton.
10036193 1999 A radiation hybrid map of 48 loci including the clouston hidrotic ectodermal dysplasia locus in the pericentromeric region of chromosome 13q.
9722999 1998 Tubulin and FtsZ structures: functional and therapeutic implications.
9465305 1998 Sequence characterization of a newly identified human alpha-tubulin gene (TUBA2).
9372968 1997 I kappaB alpha physically interacts with a cytoskeleton-associated protein through its signal response domain.
8566014 1995 Human T lymphocyte activation induces tyrosine phosphorylation of alpha-tubulin and its association with the SH2 domain of the p59fyn protein tyrosine kinase.
8530067 1995 A YAC contig and an EST map in the pericentromeric region of chromosome 13 surrounding the loci for neurosensory nonsyndromic deafness (DFNB1 and DFNA3) and limb-girdle muscular dystrophy type 2C (LGMD2C).
7651436 1995 The N-terminal domain of c-Myc associates with alpha-tubulin and microtubules in vivo and in vitro.