Property Summary

NCBI Gene PubMed Count 54
PubMed Score 40.10
PubTator Score 329.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Osteoporosis 259
Disease Target Count
Condyloma acuminatum 7
Disease Target Count P-value
inflammatory breast cancer 404 5.9e-05
Disease Target Count Z-score Confidence
Amyotrophic Lateral Sclerosis 432 3.363 1.7
Bronchiolitis Obliterans 5 3.202 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
inflammatory breast cancer 1.100 5.9e-05

Gene RIF (35)

PMID Text
26996302 Taken together our data provide valuable information regarding the interaction of CK1delta and a-tubulin and a novel approach for the development of pharmacological tools to inhibit proliferation of cancer cells.
25328666 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
24814981 NAD-dependent regulation of alpha-tubulin acetylation is mediated by SIRT2.
24760594 Results suggest that lithium chloride (LiCl) treatments activate alpha-tubulin N-acetyltransferase 1 (alphaTAT1) by the inhibition of glycogen synthase kinase 3 beta (GSK-3beta) and promote the alpha-tubulin acetylation, and then elongate the primary cilia.
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
23767669 Data indicate that the derivatives exhibited much better potency to inhibit tubulin polymerization but a decreased activity to inhibit Hsp27 chaperone function.
23625295 Increased TUBA1B expression is associated with poor overall survival in hepatocellular carcinoma.
23235160 ARHGAP21 is a Rho-GAP involved in cell-cell junction remodeling that affects migration and EMT through alpha-tubulin interaction and acetylation
22944692 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
22174317 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
21881916 TQ induced a concentration- and time-dependent degradation of alpha/beta tubulin in both cancer cell types.
21167302 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
20204303 the ethyl acetate extract of Lactuca sativa induced HL-60 cell death, which correlated with the acetylation of alpha-tubulin.
20162433 Confocal microscopic analyses showed co-localization of the TaSP protein with alpha-tubulin and reciprocal immuno-co-precipitation experiments demonstrated an association of TaSP with alpha-tubulin in vivo.
19996280 Data show that 4-oxo-4-HPR inhibited tubulin polymerization and modulated gene expression of spindle aberration associated genes Kif 1C, Kif 2A, Eg5, Tara, tankyrase-1, centractin, and TOGp.
19460752 Knockdown of tubulin, alpha 1b (TUBA1B) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19409876 alpha-tubulin interacted with ARL7.
19405953 This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia.
19215229 Increased expression of centrosomal TUBA1B in atypical ductal hyperplasia and carcinoma of the breast is reported.
19174478 These results imply that MeCP2 is involved in the regulation of neuronal alpha-tubulin and add molecular evidence that reversal of the effects of MeCP2 deficiency is achievable
18790094 mitochondrial ribosomal protein S12 3'-UTR interacts specifically with TRAP1 (tumor necrosis factor receptor-associated protein1), hnRNPM4 (heterogeneous nuclear ribonucleoprotein M4), Hsp70 and Hsp60 (heat shock proteins 70 and 60), and alpha-tubulin
18613978 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
18354170 N-terminal sequencing and blastx analysis as well as blocking with K-alpha1 tubulin-specific Ab identified the epithelial Ag as K-alpha1 tubulin[K-alpha1 tubulin]
18195004 accumulation of alpha-synuclein might contribute to the pathogenesis of PD and other Lewy body diseases by promoting alterations in parkin and tubulin solubility
17628775 Candidate gene K-ALPHA-1 expression in malignant and non-malignant prostate tissue samples after microdissection.
17360745 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
16148047 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15698476 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15691386 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15331610 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
15103018 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
12486001 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
12054644 increased levels in paclitaxel-resistant breast cancer cells
10908577 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type

AA Sequence

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL      1 - 70
EPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHS     71 - 140
FGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY    141 - 210
DICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK    211 - 280
AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG    281 - 350
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE    351 - 420
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY                                           421 - 451
//

Text Mined References (62)

PMID Year Title
26996302 2016 New potential peptide therapeutics perturbing CK1?/?-tubulin interaction.
26972003 2016 ?-Tubulin Tyrosination and CLIP-170 Phosphorylation Regulate the Initiation of Dynein-Driven Transport in Neurons.
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25908662 2015 Mitosis. Microtubule detyrosination guides chromosomes during mitosis.
25416956 2014 A proteome-scale map of the human interactome network.
24906155 2014 Molecular basis for age-dependent microtubule acetylation by tubulin acetyltransferase.
24814981 2014 Regulation of SIRT2-dependent ?-tubulin deacetylation by cellular NAD levels.
24760594 2015 The elongation of primary cilia via the acetylation of ?-tubulin by the treatment with lithium chloride in human fibroblast KD cells.
24021646 2013 Overexpression, purification, and functional analysis of recombinant human tubulin dimer.
23767669 2013 Synthesis and anticancer mechanism investigation of dual Hsp27 and tubulin inhibitors.
23625295 2013 Increased ?-tubulin1b expression indicates poor prognosis and resistance to chemotherapy in hepatocellular carcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23235160 2013 ARHGAP21 protein, a new partner of ?-tubulin involved in cell-cell adhesion formation and essential for epithelial-mesenchymal transition.
21881916 2012 Anti-neoplastic agent thymoquinone induces degradation of ? and ? tubulin proteins in human cancer cells without affecting their level in normal human fibroblasts.
21753002 2011 Parkin interacts with Ambra1 to induce mitophagy.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
20204303 2010 Anti-leukaemic effects of two extract types of Lactuca sativa correlate with the activation of Chk2, induction of p21, downregulation of cyclin D1 and acetylation of alpha-tubulin.
20162433 2010 Schizonts of Theileria annulata interact with the microtubuli network of their host cell via the membrane protein TaSP.
19996280 2009 Antimitotic effect of the retinoid 4-oxo-fenretinide through inhibition of tubulin polymerization: a novel mechanism of retinoid growth-inhibitory activity.
19524510 2009 Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation.
19409876 2009 ADP-ribosylation factor like 7 (ARL7) interacts with alpha-tubulin and modulates intracellular vesicular transport.
19405953 2009 Proteome analysis of schizophrenia patients Wernicke's area reveals an energy metabolism dysregulation.
19215229 2009 Increased expression of centrosomal alpha, gamma-tubulin in atypical ductal hyperplasia and carcinoma of the breast.
19174478 2009 MeCP2 involvement in the regulation of neuronal alpha-tubulin production.
18790094 2008 cis-acting sequences and trans-acting factors in the localization of mRNA for mitochondrial ribosomal proteins.
18457437 2008 Identification of intracellular proteins associated with the EBV-encoded nuclear antigen 5 using an efficient TAP procedure and FT-ICR mass spectrometry.
18354170 2008 De novo production of K-alpha1 tubulin-specific antibodies: role in chronic lung allograft rejection.
18195004 2008 alpha-Synuclein aggregates interfere with Parkin solubility and distribution: role in the pathogenesis of Parkinson disease.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17628775 2007 [Quantifying gene expression in prostate carcinoma. Which endogenous reference genes are suitable?].
17563362 2007 Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12750376 2003 A role for epsin N-terminal homology/AP180 N-terminal homology (ENTH/ANTH) domains in tubulin binding.
12486001 2002 HIV-1 Tat targets microtubules to induce apoptosis, a process promoted by the pro-apoptotic Bcl-2 relative Bim.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12090300 2002 Mutation analysis of 12 candidate genes for distal hereditary motor neuropathy type II (distal HMN II) linked to 12q24.3.
12087096 2002 Tubulin is an inherent component of mitochondrial membranes that interacts with the voltage-dependent anion channel.
12054644 2002 Increased levels of tyrosinated alpha-, beta(III)-, and beta(IV)-tubulin isotypes in paclitaxel-resistant MCF-7 breast cancer cells.
11953448 2002 Interaction between metabotropic glutamate receptor 7 and alpha tubulin.
11826099 2002 Process outgrowth of oligodendrocytes is promoted by interaction of fyn kinase with the cytoskeletal protein tau.
11698390 2002 Tubulin seeds alpha-synuclein fibril formation.
11580271 2001 Review: postchaperonin tubulin folding cofactors and their role in microtubule dynamics.
11535601 2001 Prefoldin recognition motifs in the nonhomologous proteins of the actin and tubulin families.
11532003 2001 Cytosolic chaperonin-containing t-complex polypeptide 1 changes the content of a particular subunit species concomitant with substrate binding and folding activities during the cell cycle.
11146551 2000 SIAH-1 interacts with alpha-tubulin and degrades the kinesin Kid by the proteasome pathway during mitosis.
11082048 2000 Identification of an alpha-tubulin mutant of fission yeast from gamma-tubulin-interacting protein screening: genetic evidence for alpha-/gamma-tubulin interaction.
10908577 2000 HIV-1 rev depolymerizes microtubules to form stable bilayered rings.
10840040 2000 Paxillin localizes to the lymphocyte microtubule organizing center and associates with the microtubule cytoskeleton.
10339593 1999 Microtubule dysfunction by posttranslational nitrotyrosination of alpha-tubulin: a nitric oxide-dependent mechanism of cellular injury.
9372968 1997 I kappaB alpha physically interacts with a cytoskeleton-associated protein through its signal response domain.
8895530 1996 A pancreatic cancer-specific expression profile.
8619814 1996 C-terminal fragments of alpha- and beta-tubulin form amyloid fibrils in vitro and associate with amyloid deposits of familial cerebral amyloid angiopathy, British type.
8098743 1993 Identification of new human receptor and transporter genes by high throughput cDNA (EST) sequencing.
8097117 1993 Site-directed mutagenesis of alpha-tubulin. Reductive methylation studies of the Lys 394 region.
7651436 1995 The N-terminal domain of c-Myc associates with alpha-tubulin and microtubules in vivo and in vitro.
7592789 1995 Phosphoinositide 3-kinase binds constitutively to alpha/beta-tubulin and binds to gamma-tubulin in response to insulin.
6646120 1983 Expression of human alpha-tubulin genes: interspecies conservation of 3' untranslated regions.