| Tchem | Tubulin alpha-1B chain |
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Comments
| Disease | Target Count |
|---|---|
| Osteoporosis | 259 |
| Disease | Target Count |
|---|---|
| Condyloma acuminatum | 7 |
| Disease | Target Count | P-value |
|---|---|---|
| inflammatory breast cancer | 404 | 5.9e-05 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Amyotrophic Lateral Sclerosis | 432 | 3.363 | 1.7 |
| Bronchiolitis Obliterans | 5 | 3.202 | 1.6 |
| PMID | Text | |
|---|---|---|
| 26996302 | Taken together our data provide valuable information regarding the interaction of CK1delta and a-tubulin and a novel approach for the development of pharmacological tools to inhibit proliferation of cancer cells. | |
| 25328666 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 24814981 | NAD-dependent regulation of alpha-tubulin acetylation is mediated by SIRT2. | |
| 24760594 | Results suggest that lithium chloride (LiCl) treatments activate alpha-tubulin N-acetyltransferase 1 (alphaTAT1) by the inhibition of glycogen synthase kinase 3 beta (GSK-3beta) and promote the alpha-tubulin acetylation, and then elongate the primary cilia. | |
| 23826228 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 23767669 | Data indicate that the derivatives exhibited much better potency to inhibit tubulin polymerization but a decreased activity to inhibit Hsp27 chaperone function. | |
| 23625295 | Increased TUBA1B expression is associated with poor overall survival in hepatocellular carcinoma. | |
| 23235160 | ARHGAP21 is a Rho-GAP involved in cell-cell junction remodeling that affects migration and EMT through alpha-tubulin interaction and acetylation | |
| 22944692 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 22174317 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 21881916 | TQ induced a concentration- and time-dependent degradation of alpha/beta tubulin in both cancer cell types. | |
| 21167302 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 20381070 | This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia | |
| 20204303 | the ethyl acetate extract of Lactuca sativa induced HL-60 cell death, which correlated with the acetylation of alpha-tubulin. | |
| 20162433 | Confocal microscopic analyses showed co-localization of the TaSP protein with alpha-tubulin and reciprocal immuno-co-precipitation experiments demonstrated an association of TaSP with alpha-tubulin in vivo. | |
| 19996280 | Data show that 4-oxo-4-HPR inhibited tubulin polymerization and modulated gene expression of spindle aberration associated genes Kif 1C, Kif 2A, Eg5, Tara, tankyrase-1, centractin, and TOGp. | |
| 19460752 | Knockdown of tubulin, alpha 1b (TUBA1B) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells | |
| 19409876 | alpha-tubulin interacted with ARL7. | |
| 19405953 | This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia. | |
| 19215229 | Increased expression of centrosomal TUBA1B in atypical ductal hyperplasia and carcinoma of the breast is reported. | |
| 19174478 | These results imply that MeCP2 is involved in the regulation of neuronal alpha-tubulin and add molecular evidence that reversal of the effects of MeCP2 deficiency is achievable | |
| 18790094 | mitochondrial ribosomal protein S12 3'-UTR interacts specifically with TRAP1 (tumor necrosis factor receptor-associated protein1), hnRNPM4 (heterogeneous nuclear ribonucleoprotein M4), Hsp70 and Hsp60 (heat shock proteins 70 and 60), and alpha-tubulin | |
| 18613978 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 18354170 | N-terminal sequencing and blastx analysis as well as blocking with K-alpha1 tubulin-specific Ab identified the epithelial Ag as K-alpha1 tubulin[K-alpha1 tubulin] | |
| 18195004 | accumulation of alpha-synuclein might contribute to the pathogenesis of PD and other Lewy body diseases by promoting alterations in parkin and tubulin solubility | |
| 17628775 | Candidate gene K-ALPHA-1 expression in malignant and non-malignant prostate tissue samples after microdissection. | |
| 17360745 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 16148047 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 15698476 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 15691386 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 15331610 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 15103018 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 12486001 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type | |
| 12054644 | increased levels in paclitaxel-resistant breast cancer cells | |
| 10908577 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type |
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL 1 - 70 EPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHS 71 - 140 FGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY 141 - 210 DICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK 211 - 280 AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG 281 - 350 FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 351 - 420 AREDMAALEKDYEEVGVDSVEGEGEEEGEEY 421 - 451 //
| PMID | Year | Title | |
|---|---|---|---|
| 26996302 | 2016 | New potential peptide therapeutics perturbing CK1?/?-tubulin interaction. | |
| 26972003 | 2016 | ?-Tubulin Tyrosination and CLIP-170 Phosphorylation Regulate the Initiation of Dynein-Driven Transport in Neurons. | |
| 26875866 | 2016 | Graded Control of Microtubule Severing by Tubulin Glutamylation. | |
| 25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. | |
| 25908662 | 2015 | Mitosis. Microtubule detyrosination guides chromosomes during mitosis. | |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 24906155 | 2014 | Molecular basis for age-dependent microtubule acetylation by tubulin acetyltransferase. | |
| 24814981 | 2014 | Regulation of SIRT2-dependent ?-tubulin deacetylation by cellular NAD levels. | |
| 24760594 | 2015 | The elongation of primary cilia via the acetylation of ?-tubulin by the treatment with lithium chloride in human fibroblast KD cells. | |
| 24021646 | 2013 | Overexpression, purification, and functional analysis of recombinant human tubulin dimer. | |
| 23767669 | 2013 | Synthesis and anticancer mechanism investigation of dual Hsp27 and tubulin inhibitors. | |
| 23625295 | 2013 | Increased ?-tubulin1b expression indicates poor prognosis and resistance to chemotherapy in hepatocellular carcinoma. | |
| 23376485 | 2013 | Proteomic analysis of podocyte exosome-enriched fraction from normal human urine. | |
| 23235160 | 2013 | ARHGAP21 protein, a new partner of ?-tubulin involved in cell-cell adhesion formation and essential for epithelial-mesenchymal transition. | |
| 21881916 | 2012 | Anti-neoplastic agent thymoquinone induces degradation of ? and ? tubulin proteins in human cancer cells without affecting their level in normal human fibroblasts. | |
| 21753002 | 2011 | Parkin interacts with Ambra1 to induce mitophagy. | |
| 21525035 | 2011 | PEX14 is required for microtubule-based peroxisome motility in human cells. | |
| 21266579 | 2011 | Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation. | |
| 20381070 | 2010 | Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia. | |
| 20204303 | 2010 | Anti-leukaemic effects of two extract types of Lactuca sativa correlate with the activation of Chk2, induction of p21, downregulation of cyclin D1 and acetylation of alpha-tubulin. | |
| 20162433 | 2010 | Schizonts of Theileria annulata interact with the microtubuli network of their host cell via the membrane protein TaSP. | |
| 19996280 | 2009 | Antimitotic effect of the retinoid 4-oxo-fenretinide through inhibition of tubulin polymerization: a novel mechanism of retinoid growth-inhibitory activity. | |
| 19524510 | 2009 | Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation. | |
| 19409876 | 2009 | ADP-ribosylation factor like 7 (ARL7) interacts with alpha-tubulin and modulates intracellular vesicular transport. | |
| 19405953 | 2009 | Proteome analysis of schizophrenia patients Wernicke's area reveals an energy metabolism dysregulation. | |
| 19215229 | 2009 | Increased expression of centrosomal alpha, gamma-tubulin in atypical ductal hyperplasia and carcinoma of the breast. | |
| 19174478 | 2009 | MeCP2 involvement in the regulation of neuronal alpha-tubulin production. | |
| 18790094 | 2008 | cis-acting sequences and trans-acting factors in the localization of mRNA for mitochondrial ribosomal proteins. | |
| 18457437 | 2008 | Identification of intracellular proteins associated with the EBV-encoded nuclear antigen 5 using an efficient TAP procedure and FT-ICR mass spectrometry. | |
| 18354170 | 2008 | De novo production of K-alpha1 tubulin-specific antibodies: role in chronic lung allograft rejection. | |
| 18195004 | 2008 | alpha-Synuclein aggregates interfere with Parkin solubility and distribution: role in the pathogenesis of Parkinson disease. | |
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. | |
| 17628775 | 2007 | [Quantifying gene expression in prostate carcinoma. Which endogenous reference genes are suitable?]. | |
| 17563362 | 2007 | Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition. | |
| 15592455 | 2005 | Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12750376 | 2003 | A role for epsin N-terminal homology/AP180 N-terminal homology (ENTH/ANTH) domains in tubulin binding. | |
| 12486001 | 2002 | HIV-1 Tat targets microtubules to induce apoptosis, a process promoted by the pro-apoptotic Bcl-2 relative Bim. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12090300 | 2002 | Mutation analysis of 12 candidate genes for distal hereditary motor neuropathy type II (distal HMN II) linked to 12q24.3. | |
| 12087096 | 2002 | Tubulin is an inherent component of mitochondrial membranes that interacts with the voltage-dependent anion channel. | |
| 12054644 | 2002 | Increased levels of tyrosinated alpha-, beta(III)-, and beta(IV)-tubulin isotypes in paclitaxel-resistant MCF-7 breast cancer cells. | |
| 11953448 | 2002 | Interaction between metabotropic glutamate receptor 7 and alpha tubulin. | |
| 11826099 | 2002 | Process outgrowth of oligodendrocytes is promoted by interaction of fyn kinase with the cytoskeletal protein tau. | |
| 11698390 | 2002 | Tubulin seeds alpha-synuclein fibril formation. | |
| 11580271 | 2001 | Review: postchaperonin tubulin folding cofactors and their role in microtubule dynamics. | |
| 11535601 | 2001 | Prefoldin recognition motifs in the nonhomologous proteins of the actin and tubulin families. | |
| 11532003 | 2001 | Cytosolic chaperonin-containing t-complex polypeptide 1 changes the content of a particular subunit species concomitant with substrate binding and folding activities during the cell cycle. | |
| 11146551 | 2000 | SIAH-1 interacts with alpha-tubulin and degrades the kinesin Kid by the proteasome pathway during mitosis. | |
| 11082048 | 2000 | Identification of an alpha-tubulin mutant of fission yeast from gamma-tubulin-interacting protein screening: genetic evidence for alpha-/gamma-tubulin interaction. | |
| 10908577 | 2000 | HIV-1 rev depolymerizes microtubules to form stable bilayered rings. | |
| 10840040 | 2000 | Paxillin localizes to the lymphocyte microtubule organizing center and associates with the microtubule cytoskeleton. | |
| 10339593 | 1999 | Microtubule dysfunction by posttranslational nitrotyrosination of alpha-tubulin: a nitric oxide-dependent mechanism of cellular injury. | |
| 9372968 | 1997 | I kappaB alpha physically interacts with a cytoskeleton-associated protein through its signal response domain. | |
| 8895530 | 1996 | A pancreatic cancer-specific expression profile. | |
| 8619814 | 1996 | C-terminal fragments of alpha- and beta-tubulin form amyloid fibrils in vitro and associate with amyloid deposits of familial cerebral amyloid angiopathy, British type. | |
| 8098743 | 1993 | Identification of new human receptor and transporter genes by high throughput cDNA (EST) sequencing. | |
| 8097117 | 1993 | Site-directed mutagenesis of alpha-tubulin. Reductive methylation studies of the Lys 394 region. | |
| 7651436 | 1995 | The N-terminal domain of c-Myc associates with alpha-tubulin and microtubules in vivo and in vitro. | |
| 7592789 | 1995 | Phosphoinositide 3-kinase binds constitutively to alpha/beta-tubulin and binds to gamma-tubulin in response to insulin. | |
| 6646120 | 1983 | Expression of human alpha-tubulin genes: interspecies conservation of 3' untranslated regions. |
