Property Summary

NCBI Gene PubMed Count 25
PubMed Score 263.82
PubTator Score 180.76

Knowledge Summary

Patent

No data available

Expression

Pathway (1)

Gene RIF (18)

PMID Text
24664737 Tubby and Tulp1 mediated phagocytosis through MerTK-dependent signaling with non-muscle myosin II redistribution leading to colocalization of phagocytosed vesicles with rearranged NMMIIA.
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides downregulate gene expression of tubby homolog, mouse (TUB) in U-937 macrophages
20978472 Tubby and Tulp1 are bridging molecules with their N-terminal region as MERTK-binding domain and C-terminal region as phagocytosis prey-binding domain.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19837063 Tubby and Tulp1 function as phagocytosis sigmals (eat-me) for retinal pigment epithelium cells and other phagocytes.
19077438 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18183286 Genetic variation of the TUB gene was associated with both body composition and macronutrient intake, suggesting that TUB might influence eating behavior
18183286 Observational study of gene-disease association. (HuGE Navigator)
17955208 TUB is a candidate gene for late-onset obesity in humans
17955208 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17498679 found the presence of tubby protein both in normal weight and in obese subjects; however in the latter an isoelectric point shift toward the acidic end was observed
16443771 Observational study of gene-disease association. (HuGE Navigator)
16443771 TUB could be an important factor in controlling the central regulation of body weight in humans.
11375483 Mouse Tubby protein may function as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis, providing a direct link between G-protein signaling and the regulation of gene expression.
10591637 Crystal structure of the core domain of the mouse Tubby protein.

AA Sequence

MTSKPHSDWIPYSVLDDEGRNLRQQKLDRQRALLEQKQKKKRQEPLMVQANADGRPRSRRARQSEEQAPL      1 - 70
VESYLSSSGSTSYQVQEADSLASVQLGATRPTAPASAKRTKAAATAGGQGGAARKEKKGKHKGTSGPAAL     71 - 140
AEDKSEAQGPVQILTVGQSDHAQDAGETAAGGGERPSGQDLRATMQRKGISSSMSFDEDEEDEEENSSSS    141 - 210
SQLNSNTRPSSATSRKSVREAASAPSPTAPEQPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGM    211 - 280
YPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNP    281 - 350
QKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTE    351 - 420
SIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQ    421 - 490
AFAIALSSFDSKLACE                                                          491 - 506
//

Text Mined References (26)

PMID Year Title
24664737 2014 Synergistic interaction of tubby and tubby-like protein 1 (Tulp1).
24375934 2014 A homozygous mutation in the TUB gene associated with retinal dystrophy and obesity.
20978472 2010 Tubby and tubby-like protein 1 are new MerTK ligands for phagocytosis.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20889716 2010 TULP3 bridges the IFT-A complex and membrane phosphoinositides to promote trafficking of G protein-coupled receptors into primary cilia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19837063 2010 Identification of tubby and tubby-like protein 1 as eat-me signals by phage display.
19077438 2009 Analysis of 30 genes (355 SNPS) related to energy homeostasis for association with adiposity in European-American and Yup'ik Eskimo populations.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18183286 2008 Polymorphisms of the TUB gene are associated with body composition and eating behavior in middle-aged women.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17955208 2008 TUB is a candidate gene for late-onset obesity in women.
17498679 2007 Tubby protein in human lymphocytes from normal weight and obese subjects.
16443771 2006 Identification of TUB as a novel candidate gene influencing body weight in humans.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11801719 2002 The tubby-like proteins, a family with roles in neuronal development and function.
11375483 2001 G-protein signaling through tubby proteins.
11000483 2000 GFP-tagged expression and immunohistochemical studies to determine the subcellular localization of the tubby gene family members.
10591637 1999 Implication of tubby proteins as transcription factors by structure-based functional analysis.
10455176 1999 Tyrosine phosphorylation of tub and its association with Src homology 2 domain-containing proteins implicate tub in intracellular signaling by insulin.
9096357 1997 Molecular characterization of TUB, TULP1, and TULP2, members of the novel tubby gene family and their possible relation to ocular diseases.
8612280 1996 Identification and characterization of the mouse obesity gene tubby: a member of a novel gene family.
1358794 1992 Localization of insulin-2 (Ins-2) and the obesity mutant tubby (tub) to distinct regions of mouse chromosome 7.