Property Summary

Ligand Count 30
NCBI Gene PubMed Count 473
PubMed Score 6198.34
PubTator Score 2584.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Amyloidosis 67
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 1.1
Disease Target Count Z-score Confidence
Transthyretin amyloidosis 1 0.0 5.0
Disease Target Count
Lattice corneal dystrophy 8

Expression

  Differential Expression (7)

Disease log2 FC p
diabetes mellitus 1.200 1.5e-03
group 3 medulloblastoma 2.600 3.5e-02
intraductal papillary-mucinous adenoma (... -2.300 1.3e-02
intraductal papillary-mucinous carcinoma... -2.400 1.8e-02
lung carcinoma 2.500 2.6e-09
osteosarcoma 2.060 1.3e-06
psoriasis 1.300 7.7e-04

 GWAS Trait (1)

Protein-protein Interaction (9)

PDB (293)

Gene RIF (332)

AA Sequence

MASHRLLLLCLAGLVFVSEAGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTS      1 - 70
ESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTA     71 - 140
VVTNPKE                                                                   141 - 147
//

Text Mined References (509)

PMID Year Title