Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.12
PubTator Score 0.18

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.100 1.5e-05
osteosarcoma -2.247 5.4e-07
pancreatic ductal adenocarcinoma liver m... -1.816 2.7e-03
non-small cell lung cancer 1.013 3.2e-12
lung cancer 1.600 1.8e-03
ovarian cancer 1.300 4.1e-04

Synonym

Accession Q9BTX7 E1P5X3 Q5QPC1 Q9H1G2 Q9NQG8
Symbols C20orf121

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSEESDSLRTSPSVASLSENELPPPPEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQALRDMVRKEYP      1 - 70
NLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSALKDVLASGFLTVLPHTDPRG     71 - 140
CHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIG    141 - 210
ILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGTAGE    211 - 280
LDTATWNAVLLASEDDFVKEFCQPVPACDSILGQTLLPEGLTSDAQCDDSLRAVKSQLYSCY            281 - 342
//

Text Mined References (7)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19946888 2010 Defining the membrane proteome of NK cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.