Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.12
PubTator Score 0.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.400 1.1e-02
malignant mesothelioma -1.100 1.5e-05
non-small cell lung cancer 1.013 3.2e-12
osteosarcoma -2.247 5.4e-07
ovarian cancer 1.300 4.1e-04
pancreatic ductal adenocarcinoma liver m... -1.816 2.7e-03

Synonym

Accession Q9BTX7 E1P5X3 Q5QPC1 Q9H1G2 Q9NQG8
Symbols C20orf121

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MSEESDSLRTSPSVASLSENELPPPPEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQALRDMVRKEYP      1 - 70
NLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSALKDVLASGFLTVLPHTDPRG     71 - 140
CHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIG    141 - 210
ILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGTAGE    211 - 280
LDTATWNAVLLASEDDFVKEFCQPVPACDSILGQTLLPEGLTSDAQCDDSLRAVKSQLYSCY            281 - 342
//

Text Mined References (7)

PMID Year Title